Tat-beclin 1
Based on 7 publication(s) in Google Scholar
Tat-beclin 1, a peptide derived from a region of the autophagy protein (beclin 1), is a potent inducer of autophagy and interacts with negative regulator of autophagy, GAPR-1 (GLIPR2). Tat-beclin 1 decreases the accumulation of polyglutamine expansion protein aggregates and the replication of several pathogens (including HIV-1) in vitro, and reduces mortality in mice infected with chikungunya (CHIKV) or West Nile virus (WNV).
Para uso exclusivo en investigación. No vendemos a pacientes.
- Pureza : 99.89%
- No. CAS: 1423821-88-8
- Fòrmula: C164H251N57O45
- Peso molecular:3741.10
-
Almacenamiento:
Sealed storage, away from moisture.
Powder -80°C, 2 years , -20°C, 1 year* In solvent : -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture)
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Actividad biológica
-
Chemical Information
-
Solvente y solubilidad
- Protocolo
- Pureza y Documentación
- Referencias
-
Help & FAQs
-
HY-P2260B
Tat-beclin 1 scrambledScrambled Control -
HY-15763
ErastinFerroptosis Inducer -
HY-100558
Bafilomycin A1V-ATPase Inhibitor -
HY-13003
Torin 1mTOR Inhibitor -
HY-16966
SBI-0206965ULK1/AMPK Inhibitor -
HY-128892
EN6Autophagy Activator -
HY-10162
OlaparibPARP Inhibitor -
HY-134923
CA77.1CMA Activator -
HY-100200
SMER28Autophagy Positive Regulator -
HY-B2098
LucanthoneAPE-1 Inhibitor -
HY-P2260C
Tat-beclin 1 scrambled TFAScrambled Control -
HY-112483
QX77CMA activator
Publications Citing Use of MedChemExpress (MCE) Tat-beclin 1
More- Autophagy. 2025 Oct;21(10):2168-2191. [Abstract]
- Clin Transl Med. 2024 Nov;14(11):e70082. [Abstract]
- Aging Cell. 2026 Aug;25(8):e70644.
- Int Immunopharmacol. 2025 Dec 3:166:115600. [Abstract]
- Sci Rep. 2025 Oct 22;15(1):36952. [Abstract]
- Bone. 2025 Mar:192:117348. [Abstract]
- Biomed Pharmacother. 2022 Oct:154:113606. [Abstract]
Actividad biológica
Descripciòn
IC50 & Target
[1]|
HIV-1 |
In Vitro
Tat-beclin 1 (10, 30, 50 μM; 24 hours) induces autophagy and results in a dose-dependent decrease in amounts of p62, a selective autophagy substrate, and a dose-dependent conversion of the non-lipidated form of LC3, LC3-I, to the lipidated, autophagosome-associated form of LC3, LC3-II, in multiple cell lines and primary murine embryonic fibroblasts (MEFs)[1].
Tat-beclin 1 (10 μM; 2-4 hours post-infection) decreases the intracellular survival of L. monocytogenes in primary murine bone-marrow-derived macrophages (BMDMs)[1].
MedChemExpress (MCE) has not independently confirmed the accuracy of these methods. They are for reference only.
In Vivo
MedChemExpress (MCE) has not independently confirmed the accuracy of these methods. They are for reference only.
Chemical Information
-
No. CAS 1423821-88-8
-
Appearance Solid
-
Peso molecular 3741.10
-
Fòrmula C164H251N57O45
-
Color White to off-white
-
Sequence
Tyr-Gly-Arg-Lys-Lys-Arg-Arg-Gln-Arg-Arg-Arg-Gly-Gly-Thr-Asn-Val-Phe-Asn-Ala-Thr-Phe-Glu-Ile-Trp-His-Asp-Gly-Glu-Phe-Gly-Thr
-
Sequence Shortening
YGRKKRRQRRRGGTNVFNATFEIWHDGEFGT
-
Envío
Room temperature in continental US; may vary elsewhere.
-
Almacenamiento
Sealed storage, away from moisture
Powder -80°C 2 years -20°C 1 year * In solvent : -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture)
Publications (7)
-
Journal Impact Factor
-
Most Recent
-
Autophagy
METTL3-dependent m6A modification of SNAP29 induces "autophagy-mitochondrial crisis" in the ischemic microenvironment after soft tissue transplantation. [Abstract]2025 Oct;21(10):2168-2191. PMID: 40340690 -
Clin Transl Med
Targeting endoplasmic reticulum stress-induced lymphatic dysfunction for mitigating bisphosphonate-related osteonecrosis. [Abstract]2024 Nov;14(11):e70082. PMID: 39521624 -
-
Int Immunopharmacol
2025 Dec 3:166:115600. PMID: 41045801 -
Sci Rep
Lysosomal homeostasis regulates myocardial ischemia-reperfusion injury through autophagy pathway. [Abstract]2025 Oct 22;15(1):36952. PMID: 41125732 -
Bone
2025 Mar:192:117348. PMID: 39617111 -
Biomed Pharmacother
Novel cardioprotective mechanism for Empagliflozin in nondiabetic myocardial infarction with acute hyperglycemia. [Abstract]2022 Oct:154:113606. PMID: 36030589
Solvente y solubilidad
In Vitro:
H2O : 25 mg/mL (6.68 mM; Need ultrasonic)
Please refer to the solubility information to select the appropriate solvent. Once prepared, please aliquot and store the solution to prevent product inactivation from repeated freeze-thaw cycles.
Storage method and period of stock solution: -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture). When stored at -80°C, please use it within 6 months. When stored at -20°C, please use it within 1 month.
* Note: If you choose water as the stock solution, please dilute it to the working solution, then filter and sterilize it with a 0.22 μm filter before use.
Please refer to the solubility information to select the appropriate solvent. Once prepared, please aliquot and store the solution to prevent product inactivation from repeated freeze-thaw cycles.
Storage method and period of stock solution: -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture). When stored at -80°C, please use it within 6 months. When stored at -20°C, please use it within 1 month.
* Note: If you choose water as the stock solution, please dilute it to the working solution, then filter and sterilize it with a 0.22 μm filter before use.
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Pureza y Documentación
-
Ficha de datos (284 KB)
-
SDS (254 KB)
- English - EN (254 KB)
- Français - FR (254 KB)
- Deutsch - DE (254 KB)
- Norwegian - NO (254 KB)
- Español - ES (254 KB)
- Swedish - SV (254 KB)
- Italian - IT (254 KB)
- Korean - KR (254 KB)
- Portuguese - PT (254 KB)
-
Instrucciones de manejo (2659 KB)
Referencias
Complete Stock Solution Preparation Table
Please refer to the solubility information to select the appropriate solvent. Once prepared, please aliquot and store the solution to prevent product inactivation from repeated freeze-thaw cycles.
Storage method and period of stock solution: -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture). When stored at -80°C, please use it within 6 months. When stored at -20°C, please use it within 1 month.
| Optional Solvent | Concentration Solvent Mass | 1 mg | 5 mg | 10 mg | 25 mg |
|---|---|---|---|---|---|
| H2O | 1 mM | 0.2673 mL | 1.3365 mL | 2.6730 mL | 6.6825 mL |
| 5 mM | 0.0535 mL | 0.2673 mL | 0.5346 mL | 1.3365 mL |
* Note: If you choose water as the stock solution, please dilute it to the working solution, then filter and sterilize it with a 0.22 μm filter before use.
Tat-beclin 1 Related Classifications
HY-P2260 Related Classifications
Powered by Bioz