Tat-beclin 1
Based on 7 publication(s) in Google Scholar
Tat-beclin 1, a peptide derived from a region of the autophagy protein (beclin 1), is a potent inducer of autophagy and interacts with negative regulator of autophagy, GAPR-1 (GLIPR2). Tat-beclin 1 decreases the accumulation of polyglutamine expansion protein aggregates and the replication of several pathogens (including HIV-1) in vitro, and reduces mortality in mice infected with chikungunya (CHIKV) or West Nile virus (WNV).
For research use only. We do not sell to patients.
- Purity: 99.89%
- CAS No.: 1423821-88-8
- Formula: C164H251N57O45
- Molecular Weight:3741.10
-
Storage:
Sealed storage, away from moisture.
Powder -80°C, 2 years , -20°C, 1 year* In solvent : -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture)
Publications Citing Use of MedChemExpress (MCE) Tat-beclin 1
More- Autophagy. 2025 Oct;21(10):2168-2191. [Abstract]
- Clin Transl Med. 2024 Nov;14(11):e70082. [Abstract]
- Aging Cell. 2026 Aug;25(8):e70644.
- Int Immunopharmacol. 2025 Dec 3:166:115600. [Abstract]
- Sci Rep. 2025 Oct 22;15(1):36952. [Abstract]
- Bone. 2025 Mar:192:117348. [Abstract]
- Biomed Pharmacother. 2022 Oct:154:113606. [Abstract]
Biological Activity
|
HIV-1 |
Tat-beclin 1 (10, 30, 50 μM; 24 hours) induces autophagy and results in a dose-dependent decrease in amounts of p62, a selective autophagy substrate, and a dose-dependent conversion of the non-lipidated form of LC3, LC3-I, to the lipidated, autophagosome-associated form of LC3, LC3-II, in multiple cell lines and primary murine embryonic fibroblasts (MEFs)[1].
Tat-beclin 1 (10 μM; 2-4 hours post-infection) decreases the intracellular survival of L. monocytogenes in primary murine bone-marrow-derived macrophages (BMDMs)[1].
MedChemExpress (MCE) has not independently confirmed the accuracy of these methods. They are for reference only.
MedChemExpress (MCE) has not independently confirmed the accuracy of these methods. They are for reference only.
Chemical Information
-
CAS No. 1423821-88-8
-
Appearance Solid
-
Molecular Weight 3741.10
-
Formula C164H251N57O45
-
Color White to off-white
-
Sequence
Tyr-Gly-Arg-Lys-Lys-Arg-Arg-Gln-Arg-Arg-Arg-Gly-Gly-Thr-Asn-Val-Phe-Asn-Ala-Thr-Phe-Glu-Ile-Trp-His-Asp-Gly-Glu-Phe-Gly-Thr
-
Sequence Shortening
YGRKKRRQRRRGGTNVFNATFEIWHDGEFGT
-
Shipping
Room temperature in continental US; may vary elsewhere.
-
Storage
Sealed storage, away from moisture
Powder -80°C 2 years -20°C 1 year * In solvent : -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture)
Publications (7)
-
Journal Impact Factor
-
Most Recent
-
Autophagy
METTL3-dependent m6A modification of SNAP29 induces "autophagy-mitochondrial crisis" in the ischemic microenvironment after soft tissue transplantation. [Abstract]2025 Oct;21(10):2168-2191. PMID: 40340690 -
Clin Transl Med
Targeting endoplasmic reticulum stress-induced lymphatic dysfunction for mitigating bisphosphonate-related osteonecrosis. [Abstract]2024 Nov;14(11):e70082. PMID: 39521624 -
-
Int Immunopharmacol
2025 Dec 3:166:115600. PMID: 41045801 -
Sci Rep
Lysosomal homeostasis regulates myocardial ischemia-reperfusion injury through autophagy pathway. [Abstract]2025 Oct 22;15(1):36952. PMID: 41125732 -
Bone
2025 Mar:192:117348. PMID: 39617111 -
Biomed Pharmacother
Novel cardioprotective mechanism for Empagliflozin in nondiabetic myocardial infarction with acute hyperglycemia. [Abstract]2022 Oct:154:113606. PMID: 36030589
Solvent & Solubility
H2O : 25 mg/mL (6.68 mM; Need ultrasonic)
Please refer to the solubility information to select the appropriate solvent. Once prepared, please aliquot and store the solution to prevent product inactivation from repeated freeze-thaw cycles.
Storage method and period of stock solution: -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture). When stored at -80°C, please use it within 6 months. When stored at -20°C, please use it within 1 month.
* Note: If you choose water as the stock solution, please dilute it to the working solution, then filter and sterilize it with a 0.22 μm filter before use.
Please refer to the solubility information to select the appropriate solvent. Once prepared, please aliquot and store the solution to prevent product inactivation from repeated freeze-thaw cycles.
Storage method and period of stock solution: -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture). When stored at -80°C, please use it within 6 months. When stored at -20°C, please use it within 1 month.
* Note: If you choose water as the stock solution, please dilute it to the working solution, then filter and sterilize it with a 0.22 μm filter before use.
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Purity & Documentation
-
Data Sheet (282 KB)
-
SDS (252 KB)
- English - EN (252 KB)
- Français - FR (252 KB)
- Deutsch - DE (252 KB)
- Norwegian - NO (252 KB)
- Español - ES (252 KB)
- Swedish - SV (252 KB)
- Italian - IT (252 KB)
- Korean - KR (252 KB)
- Portuguese - PT (252 KB)
-
Handling Instructions (2659 KB)
References
Complete Stock Solution Preparation Table
Please refer to the solubility information to select the appropriate solvent. Once prepared, please aliquot and store the solution to prevent product inactivation from repeated freeze-thaw cycles.
Storage method and period of stock solution: -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture). When stored at -80°C, please use it within 6 months. When stored at -20°C, please use it within 1 month.
| Optional Solvent | Concentration Solvent Mass | 1 mg | 5 mg | 10 mg | 25 mg |
|---|---|---|---|---|---|
| H2O | 1 mM | 0.2673 mL | 1.3365 mL | 2.6730 mL | 6.6825 mL |
| 5 mM | 0.0535 mL | 0.2673 mL | 0.5346 mL | 1.3365 mL |
* Note: If you choose water as the stock solution, please dilute it to the working solution, then filter and sterilize it with a 0.22 μm filter before use.