2. Peptides
  3. Tat-peptide control 168-189 TFA

Tat-peptide 168-189 is a cell-permeable and Tat-labeled fusion peptide, corresponding to residues 168-189 of rat G3BP1. Tat sequence from HIV, is placed at the least conserved end of the sequence, for cell permeability. Tat-peptide 168-189 is the negtive control of Tat-peptide 168-189 TFA (HY-P5118A), as Tat-peptide 168-189 TFA increases axon growth and increases the number of neurites per neuron.

For research use only. We do not sell to patients.

Custom Peptide Synthesis

Tat-peptide control 168-189 TFA Chemical Structure

Tat-peptide control 168-189 TFA Chemical Structure

Size Price Stock
1 mg USD 520 Ask For Quote & Lead Time

* Please select Quantity before adding items.

This product is a controlled substance and not for sale in your territory.

Other Forms of Tat-peptide control 168-189 TFA:

Tat-peptide control 168-189 TFA Related Antibodies

Top Publications Citing Use of Products

  • Biological Activity

  • Purity & Documentation

  • References

  • Customer Review

Description

Tat-peptide 168-189 is a cell-permeable and Tat-labeled fusion peptide, corresponding to residues 168-189 of rat G3BP1. Tat sequence from HIV, is placed at the least conserved end of the sequence, for cell permeability. Tat-peptide 168-189 is the negtive control of Tat-peptide 168-189 TFA (HY-P5118A), as Tat-peptide 168-189 TFA increases axon growth and increases the number of neurites per neuron[1].

In Vitro

Tat-peptide 168-189 TFA (10 μM, 20 μM; 24 h) increases axon length in dissociated DRG cultures with 10 μM, as well as in iMotor neurons with 20 μM[1].
Tat-peptide 168-189 TFA (10 μM; 3 d) increases the overall number of neurites extended from each neuron[1].

MedChemExpress (MCE) has not independently confirmed the accuracy of these methods. They are for reference only.

Tat-peptide control 168-189 TFA Related Antibodies
Molecular Weight

4030.99

Formula

C162H239N47O65S.C2HF3O2
Appearance

Solid

Color

White to off-white

Sequence

Asp-Asp-Ser-Gly-Thr-Phe-Tyr-Asp-Gln-Ala-Val-Val-Ser-Asn-Asp-Met-Glu-Glu-His-Leu-Glu-Glu-Pro-Tyr-Gly-Asn-Lys-Lys-Asn-Asn-Gln-Asn-Asn-Asn
Sequence Shortening

DDSGTFYDQAVVSNDMEEHLEEPYGNKKNNQNNN
Shipping

Room temperature in continental US; may vary elsewhere.
Storage

Sealed storage, away from moisture and light, under nitrogen

Powder -80°C 2 years
-20°C 1 year

*In solvent : -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture and light, under nitrogen)

Purity & Documentation
References
  • No file chosen (Maximum size is: 1024 Kb)
  • If you have published this work, please enter the PubMed ID.
  • Your name will appear on the site.

  • Molarity Calculator

  • Dilution Calculator

The molarity calculator equation

Mass (g) = Concentration (mol/L) × Volume (L) × Molecular Weight (g/mol)

Mass   Concentration   Volume   Molecular Weight *
= × ×

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2
Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

Keywords:

Tat-peptide control 168-189Otherscell-permeablefusion peptideG3BP1axon growthneuritesaxon intrinsic mechanismischemic protectionendovascular repairintracranial aneurysmsInhibitorinhibitorinhibit

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

  

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

      

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Tat-peptide control 168-189 TFA
Cat. No.:
HY-P5119A
Quantity:
MCE Japan Authorized Agent:

Customer Review

Thank You for Your Feedback!

Request for HNMR Report

Please fill out this form to request the QC report. We will send it to your Email address shortly.

Your information is safe with us. * Required Fields.

Product Name

  

Lot #

Applicant Name *

 

Email Address *

Phone Number

 

Department *

Organization Name *

 

Country or Region *

Remarks

Request for HNMR Report

We have received your request and will respond to you as soon as possible.