Tat-peptide 190-208 TFA
Based on 1 Customer Validation
Tat-peptide 190-208 TFA is a cell-permeable and Tat-labeled fusion peptide, corresponding to residues 190-208 of rat G3BP1. Tat sequence from HIV, is placed at the least conserved end of the sequence, for cell permeability. Tat-peptide 190-208 TFA increases axon growth and increases the number of neurites per neuron. Tat-peptide 190-208 TFA likely exhibits an axon intrinsic mechanism. Tat-peptide 190-208 TFA can be used for ischemic protection during endovascular repair for intracranial aneurysms.
For research use only. We do not sell to patients.
- Purity : 98.41%
- Formula: C142H214N40O57·xC2HF3O2
- Molecular Weight:3393.45 (free base)
-
Storage:
Sealed storage, away from moisture and light, under nitrogen.
Powder -80°C, 2 years , -20°C, 1 year* In solvent : -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture and light, under nitrogen)
Biological Activity
Description
In Vitro
Tat-peptide 190-208 TFA (10 μM, 20 μM; 24 h) increases axon length in dissociated DRG cultures with 10 μM, as well as in iMotor neurons with 20 μM[1].
Tat-peptide 190-208 TFA (10 μM; 3 d) increases the overall number of neurites extended from each neuron[1].
MedChemExpress (MCE) has not independently confirmed the accuracy of these methods. They are for reference only.
Chemical Information
-
Appearance Solid
-
Molecular Weight 3393.45 (free base)
-
Formula C142H214N40O57·xC2HF3O2
-
Color White to off-white
-
Sequence
Tyr-Gly-Asn-Lys-Lys-Asn-Asn-Gln-Asn-Asn-Asn-Val-Ala-Glu-Pro-Glu-Pro-Asp-Pro-Glu-Pro-Glu-Pro-Glu-Gln-Glu-Pro-Val-Ser-Glu
-
Sequence Shortening
YGNKKNNQNNNVAEPEPDPEPEPEQEPVSE
-
Shipping
Room temperature in continental US; may vary elsewhere.
-
Storage
Sealed storage, away from moisture and light, under nitrogen
Powder -80°C 2 years -20°C 1 year * In solvent : -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture and light, under nitrogen)
Purity & Documentation
-
Data Sheet (277 KB)
-
SDS (252 KB)
- English - EN (252 KB)
- Français - FR (252 KB)
- Deutsch - DE (252 KB)
- Norwegian - NO (252 KB)
- Español - ES (252 KB)
- Swedish - SV (252 KB)
- Italian - IT (252 KB)
- Korean - KR (252 KB)
- Portuguese - PT (252 KB)
-
Handling Instructions (2659 KB)
References
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)