retro-inverso TAT-Beclin 1 (D-amino acid)
retro-inverso TAT-Beclin 1 D-amino acid is has higher activity and resistance to proteolytic degradation in vivo compared to L-amino acids peptide. TAT-Beclin 1 can induce autophagy in peripheral tissues in adult mice as well as in the central nervous system of neonatal mice.
For research use only. We do not sell to patients.
- Formula: C164H251N57O45
- Molecular Weight:3741.10
-
Storage:
Please store the product under the recommended conditions in the Certificate of Analysis.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Chemical Information
- Purity & Documentation
- References
-
Help & FAQs
Biological Activity
Description
Chemical Information
-
Molecular Weight 3741.10
-
Formula C164H251N57O45
-
Sequence
d-(Arg-Arg-Arg-Gln-Arg-Arg-Lys-Lys-Arg-Gly-Tyr-Gly-Gly-Thr-Gly-Phe-Glu-Gly-Asp-His-Trp-Ile-Glu-Phe-Thr-Ala-Asn-Phe-Val-Asn-Thr)
-
Sequence Shortening
d-(RRRQRRKKRGYGGTGFEGDHWIEFTANFVNT)
-
Shipping
Room temperature in continental US; may vary elsewhere.
-
Storage
Please store the product under the recommended conditions in the Certificate of Analysis.
Purity & Documentation
References
[1]. Yanfei He, et al. Development of an autophagy activator from Class III PI3K complexes, Tat-BECN1 peptide: Mechanisms and applications. Front Cell Dev Biol. 2022 Sep 12:10:851166. [Content Brief]
[2]. Sanae Shoji-Kawata, et al. Identification of a candidate therapeutic autophagy-inducing peptide. Nature. 2013 Feb 14;494(7436):201-6. [Content Brief]
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
retro-inverso TAT-Beclin 1 (D-amino acid) Related Classifications
HY-P10110 Related Classifications
Powered by Bioz