Search Result
Results for "
amino-acid
" in MedChemExpress (MCE) Product Catalog:
1218
Inhibitors & Agonists
3
Biochemical Assay Reagents
| Cat. No. |
Product Name |
Target |
Research Areas |
Chemical Structure |
-
- HY-P4146
-
|
BI 456906
|
GLP Receptor
GCGR
|
Metabolic Disease
|
|
Survodutide (BI 456906) is a potent, selective glucagon receptor/GLP-1 receptor (GCGR/GLP-1R) dual agonist with EC50s of 0.52 nM and 0.33 nM in CHO-K1 cells, respectively. Survodutide, a 29-amino-acid peptide, is a potent acylated peptide containing a C18 fatty acid. Survodutide has robust anti-obesity efficacy achieved by increasing energy expenditure and decreasing food intake .
|
-
-
- HY-P4146A
-
|
BI 456906 TFA
|
GLP Receptor
GCGR
|
Metabolic Disease
|
|
Survodutide (BI 456906) TFA is a potent, selective glucagon receptor/GLP-1 receptor (GCGR/GLP-1R) dual agonist with EC50s of 0.52 nM and 0.33 nM in CHO-K1 cells, respectively. Survodutide TFA, a 29-amino-acid peptide, is a potent acylated peptide containing a C18 fatty acid. Survodutide TFA has robust anti-obesity efficacy achieved by increasing energy expenditure and decreasing food intake .
|
-
-
- HY-P3581
-
|
|
Potassium Channel
|
Neurological Disease
|
|
PE 22-28 is a TREK-1 inhibitor with IC50 value of 0.12 nM. PE 22-28 also is a 7 amino-acid peptide that is used as a core sequence for preparing analogs by chemical modifications and also by substitution of amino-acids. PE 22-28 can be used for the research of depression .
|
-
-
- HY-P1511
-
-
-
- HY-P0173A
-
|
|
Chloride Channel
|
Cancer
|
|
Chlorotoxin is a 36 amino-acid peptide from the venom of the Israeli scorpion Leiurus quinquestriatus with anticancer activity. Chlorotoxin is a chloride channel blocker.
|
-
-
- HY-P2207
-
|
|
Biochemical Assay Reagents
|
Others
|
|
Sinapultide is a 21-amino-acid peptide that mimics the action of human surfactant protein-B (SP-B). Sinapultide can be used for synthetic phospholipids surfactants improvement .
|
-
-
- HY-P3811
-
|
|
CaMK
|
Neurological Disease
|
|
Autocamtide-3, a 13-amino-acid peptide containing Thr287, is a selective CaMKII (Ca 2+/calmodulin-dependent kinase II) (CaMK) substrate .
|
-
-
- HY-P3811A
-
|
|
CaMK
|
Neurological Disease
|
|
Autocamtide-3 acetate, a 13-amino-acid peptide containing Thr287, is a selective CaMKII (Ca 2+/calmodulin-dependent kinase II) (CaMK) substrate .
|
-
-
- HY-P0285
-
|
|
RABV
|
Infection
|
|
Rabies Virus Glycoprotein is a 29-amino-acid cell penetrating peptide derived from a rabies virus glycoprotein that can cross the blood-brain barrier (BBB) and enter brain cells.
|
-
-
- HY-P2207A
-
|
|
Biochemical Assay Reagents
|
Others
|
|
Sinapultide TFA is a 21-amino-acid peptide that mimics the action of human surfactant protein-B (SP-B). Sinapultide TFA can be used for synthetic phospholipids surfactants improvement .
|
-
-
- HY-P0285A
-
|
|
RABV
|
Infection
|
|
Rabies Virus Glycoprotein (TFA) is a 29-amino-acid cell penetrating peptide derived from a rabies virus glycoprotein that can cross the blood-brain barrier (BBB) and enter brain cells .
|
-
-
- HY-111149
-
|
|
CXCR
|
Inflammation/Immunology
|
|
PS372424, a three amino-acid fragment of CXCL10, is a specific human CXCR3 agonist with anti-inflammatory activity. PS372424 prevents human T-cell migration in a humanized model of arthritic inflammation .
|
-
-
- HY-111149A
-
|
|
CXCR
|
Inflammation/Immunology
|
|
PS372424 hydrochloride, a three amino-acid fragment of CXCL10, is a specific human CXCR3 agonist with anti-inflammatory activity. PS372424 hydrochloride prevents human T-cell migration in a humanized model of arthritic inflammation .
|
-
-
- HY-P1714
-
|
FE 203799
|
GLP Receptor
|
Metabolic Disease
|
|
Apraglutide (FE 203799), a synthetic 33-amino-acid peptide and a long-acting GLP-2 analogue, enhances adaptation and linear intestinal growth in a neonatal piglet model of short bowel syndrome with total resection of the ileum .
|
-
-
- HY-P1714A
-
|
FE 203799 TFA
|
GLP Receptor
|
Metabolic Disease
|
|
Apraglutide TFA (FE 203799 TFA), a synthetic 33-amino-acid peptide and a long-acting GLP-2 analogue, enhances adaptation and linear intestinal growth in a neonatal piglet model of short bowel syndrome with total resection of the ileum .
|
-
-
- HY-P1298
-
|
|
CRFR
|
Cardiovascular Disease
Neurological Disease
Endocrinology
|
|
Sauvagine, a 40-amino-acid neuropeptide from the skin of the frog, is a mammalian CRF agonist. Sauvagine is effective at releasing ACTH from rat pituitary cells. Sauvagine possesses a number of pharmacological actions on diuresis, the cardiovascular system and endocrine glands .
|
-
-
- HY-P1293
-
|
|
iGluR
|
Neurological Disease
|
|
Conantokin G, a 17-amino-acid peptide, is a potent, selective and competitive antagonist of N-methyl-D-aspartate (NMDA) receptors. Conantokin G inhibits NMDA-evoked currents in murine cortical neurons with an IC50 of 480 nM. Conantokin G has neuroprotective properties .
|
-
-
- HY-P1298A
-
|
|
CRFR
|
Cardiovascular Disease
Neurological Disease
Endocrinology
|
|
Sauvagine TFA, a 40-amino-acid neuropeptide from the skin of the frog, is a mammalian CRF agonist. Sauvagine TFA is effective at releasing ACTH from rat pituitary cells. Sauvagine TFA possesses a number of pharmacological actions on diuresis, the cardiovascular system and endocrine glands .
|
-
-
- HY-P1293A
-
|
|
iGluR
|
Neurological Disease
|
|
Conantokin G TFA, a 17-amino-acid peptide, is a potent, selective and competitive antagonist of N-methyl-D-aspartate (NMDA) receptors. Conantokin G TFA inhibits NMDA-evoked currents in murine cortical neurons with an IC50 of 480 nM. Conantokin G TFA has neuroprotective properties .
|
-
-
- HY-P1525
-
|
MCH (salmon)
|
MCHR1 (GPR24)
|
Cardiovascular Disease
Neurological Disease
Metabolic Disease
Endocrinology
|
|
Melanin Concentrating Hormone, salmon is a 19-amino-acid neuropeptide initially identified in the pituitary gland of teleost fish, which regulates food intake, energy balance, sleep state, and the cardiovascular system. Melanin-concentrating hormone is a ligand for an orphan G protein-coupled receptor (SLC-1/GPR24) and MCHR2.
|
-
-
- HY-105037
-
|
IPP-201101
|
Autophagy
|
Inflammation/Immunology
|
|
Forigerimod (IPP-201101) is a CD4 T-cell modulator. Forigerimod is a 21-amino-acid fragment of U1 small nuclear ribonucleoprotein 70 kDa that is phosphorylated at Ser140. Forigerimod can potently inhibit autophagy. Forigerimod can be used for the research of autoimmune disorders, such as systemic lupus erythematosus (SLE) .
|
-
-
- HY-P1674A
-
|
POL7080 TFA
|
Bacterial
Antibiotic
|
Infection
|
|
Murepavadin (POL7080) (TFA), a 14-amino-acid cyclic peptide, is a highly potent, specific antibiotic. Murepavadin exhibits a potent antimicrobial activity for P. aeruginosa with MIC50 and MIC90 values both of 0.12 mg/L. Murepavadin also can target the lipopolysaccharide transport portin D. Murepavadin can be used for the research of bacterial resistance .
|
-
-
- HY-P2230
-
|
A6 Peptide
|
PAI-1
|
Cancer
|
|
Angstrom6 (A6 Peptide) is an 8 amino-acid peptide derived from single-chain urokinase plasminogen activator (scuPA) and interferes with the uPA/uPAR cascade and abrogates downstream effects. Angstrom6 binds to CD44 resulting in the inhibition of migration, invasion, and metastasis of tumor cells, and the modulation of CD44-mediated cell signaling .
|
-
-
- HY-P1674
-
|
POL7080
|
Bacterial
Antibiotic
|
Infection
|
|
Murepavadin (POL7080), a 14-amino-acid cyclic peptide, is a highly potent, specific antibiotic. Murepavadin exhibits a potent antimicrobial activity for P. aeruginosa with both MIC50 and MIC90 values of 0.12 mg/L. Murepavadin also can target the lipopolysaccharide transport portin D. Murepavadin can be used for the research of bacterial resistance .
|
-
-
- HY-P1525A
-
|
MCH (salmon) (TFA)
|
MCHR1 (GPR24)
|
Cardiovascular Disease
Neurological Disease
Metabolic Disease
Endocrinology
|
|
Melanin Concentrating Hormone, salmon TFA (MCH (salmon) TFA) is a 19-amino-acid neuropeptide initially identified in the pituitary gland of teleost fish, which regulates food intake, energy balance, sleep state, and the cardiovascular system. Melanin-concentrating hormone is a ligand for an orphan G protein-coupled receptor (SLC-1/GPR24) and MCHR2.
|
-
-
- HY-105037A
-
|
IPP-201101 TFA
|
Autophagy
|
Inflammation/Immunology
|
|
Forigerimod TFA (IPP-201101 TFA) is a CD4 T-cell modulator. Forigerimod TFA is a 21-amino-acid fragment of U1 small nuclear ribonucleoprotein 70 kDa that is phosphorylated at Ser140. Forigerimod TFA can potently inhibit autophagy. Forigerimod can be used for the research of autoimmune disorders, such as systemic lupus erythematosus (SLE) .
|
-
-
- HY-P3431
-
|
|
iGluR
|
Neurological Disease
|
|
VSGLNPSLWSIFGLQFILLWLVSGSRHYLW is a 30-amino-acid peptide mimicking the C-terminal domain of α2δ-1, termed as α2δ-1Tat peptide. VSGLNPSLWSIFGLQFILLWLVSGSRHYLW can effectively interrupt the α2δ-1 - NMDAR interaction in vitro and in vivo. VSGLNPSLWSIFGLQFILLWLVSGSRHYLW can be used for researching neuropathic pain .
|
-
-
- HY-P3906
-
|
|
Fungal
Apoptosis
Phospholipase
Reactive Oxygen Species
|
Infection
|
|
Melittin free acid is a basic 26-amino-acid polypeptide, the major active ingredient of honeybee venom. Melittin free acid is an activator of phospholipase A2 (PLA2). Melittin free acid has broad-spectrum antifungal activity with MIC values of 0.4-60 μM. Melittin free acid hinders fungal growth by inducing cell apoptosis, repressing (1,3)-β-D-glucan synthase and participating in other pathways .
|
-
-
- HY-P3431A
-
|
|
iGluR
|
Neurological Disease
|
|
VSGLNPSLWSIFGLQFILLWLVSGSRHYLW (TFA) is a 30-amino-acid peptide mimicking the C-terminal domain of α2δ-1, termed as α2δ-1Tat peptide. VSGLNPSLWSIFGLQFILLWLVSGSRHYLW can effectively interrupt the α2δ-1 - NMDAR interaction in vitro and in vivo. VSGLNPSLWSIFGLQFILLWLVSGSRHYLW can be used for researching neuropathic pain .
|
-
-
- HY-P10200
-
|
|
Bacterial
|
Infection
|
|
CP7-FP13-2 is a peptide with antivirulence factor and antibacterial activity. CP7-FP13-2 inhibits the formation of Staphylococcus aureus biofilm and has good antibacterial efficacy in mice .
|
-
-
- HY-P3462
-
|
|
CGRP Receptor
|
Metabolic Disease
|
|
Cagrilintide is an investigational novel long-acting acylated amylin analogue, acts as nonselective amylin receptors (AMYR) and calcitonin G protein-coupled receptor (CTR) agonist. Cagrilintide induces significant weight loss and reduces food intake. Cagrilintide has the potential for the research of obesity .
|
-
-
- HY-P3462A
-
|
|
CGRP Receptor
|
Metabolic Disease
|
|
Cagrilintide acetate is a non-selective AMYR/CTR agonist and long-acting acylated amylase analogue. Cagrilintide acetate causes a reduction in food intake and significant weight loss in a dose-dependent manner. Cagrilintide acetate can be used in obesity studies .
|
-
-
- HY-P5161A
-
|
|
GCGR
|
Metabolic Disease
|
|
FC382K10W15 TFA is a glucagon analogue and GLP-1R/GCGR agonist. FC382K10W15 TFA can be used in type 2 diabetes research .
|
-
-
- HY-P0041A
-
-
-
- HY-P3143
-
|
|
PD-1/PD-L1
|
Cancer
|
|
BMSpep-57 is a potent and competitive macrocyclic peptide inhibitor of PD-1/PD-L1 interaction with an IC50 of 7.68 nM. BMSpep-57 binds to PD-L1 with Kds of 19 nM and 19.88 nM in MST and SPR assays, respectively. BMSpep-57 facilitates T cell function by in creasing IL-2 production in PBMCs .
|
-
-
- HY-P3143A
-
|
|
PD-1/PD-L1
|
Cancer
|
|
BMSpep-57 hydrochloride is a potent and competitive macrocyclic peptide inhibitor of PD-1/PD-L1 interaction with an IC50 of 7.68 nM. BMSpep-57 hydrochloride binds to PD-L1 with Kds of 19 nM and 19.88 nM in MST and SPR assays, respectively. BMSpep-57 hydrochloride facilitates T cell function by in creasing IL-2 production in PBMCs .
|
-
-
- HY-P1162
-
-
-
- HY-P2434
-
|
|
Somatostatin Receptor
|
Neurological Disease
Metabolic Disease
Cancer
|
|
AP102 is a dual SSTR2/SSTR5-specific somatostatin analog (SSA). AP102 is a disulfide-bridged octapeptide SSA containing synthetic iodinated amino acids. AP102 binds with subnanomolar affinity to SSTR2 and SSTR5 (IC50: 0.63 and 0.65 nM, respectively). AP102 does not bind to SSTR1 or SSTR3. AP102 can be used for acromegaly and neuroendocrine tumors research .
|
-
-
- HY-P10031
-
|
|
GLP Receptor
GCGR
|
Metabolic Disease
|
|
SAR441255 is a potent unimolecular peptide GLP-1/GIP/GCG receptor triagonist. SAR441255 displays high potency with balanced activation of all three target receptors.?SAR441255 shows positive acute glucoregulatory effectss in diabetic obese monkeys .
|
-
-
- HY-P10031A
-
|
|
GLP Receptor
|
Metabolic Disease
|
|
SAR441255 TFA is a potent unimolecular peptide GLP-1/GIP/GCG receptor triagonist. SAR441255 TFA displays high potency with balanced activation of all three target receptors.?SAR441255 TFA shows positive acute glucoregulatory effectss in diabetic obese monkeys .
|
-
-
- HY-P4895
-
|
|
Oxytocin Receptor
|
Neurological Disease
|
|
(d(CH2)51,Tyr(Me)2,Orn8)-Oxytocin (OVT) is an oxytocin receptor antagonist. (d(CH2)51,Tyr(Me)2,Orn8)-Oxytocin can be used for the research of neurological disease .
|
-
-
- HY-P5362
-
|
|
Somatostatin Receptor
|
Cancer
|
|
NODAGA-LM3 can be labeled by 68Ga for PET imaging. 68Ga-NODAGA-LM3 is a SSTR2 antagonist, and can be used for imaging of SSTR positive paragangliomas .
|
-
-
- HY-P5362A
-
|
|
Somatostatin Receptor
|
Cancer
|
|
NODAGA-LM3 TFA can be labeled by 68Ga for PET imaging. 68Ga-NODAGA-LM3 TFA is a SSTR2 antagonist, and can be used for imaging of SSTR positive paragangliomas .
|
-
-
- HY-105168
-
|
|
Endothelin Receptor
|
Cardiovascular Disease
|
|
TAK 044 is an antagonist of Endothelin Receptor. TAK 044 strongly inhibits ET-induced deterioration in various animal models. TAK 044 can be used in study ET-related diseases such as acute myocardial infarction,acute renal failure, acute hepatic malfunction, and subarachnoid hemorrhage .
|
-
-
- HY-14743
-
|
SCV 07; Gamma-D-glutamyl-L-tryptophan
|
Bacterial
STAT
|
Infection
Inflammation/Immunology
Cancer
|
|
Golotimod (SCV-07), an immunomodulating peptide with antimicrobial activity, significantly increases the efficacy of antituberculosis therapy, stimulates thymic and splenic cell proliferation, and improves macrophage function. Golotimod (SCV-07) inhibits STAT3 signaling and modulates the duration and severity of oral mucositis in animal models that received radiation or a combination of radiation and Cisplatin. Golotimod (SCV-07) is also a potential therapeutic for recurrent genital herpes simplex virus type 2 (HSV-2) .
|
-
-
- HY-W013097
-
|
|
Amino Acid Derivatives
|
Others
|
|
Boc-Arg(di-Z)-OH can be used for the synthesis of amino acid. Boc-Arg(di-Z)-OH can be used for the research of inhibitors for processing proteinases. Boc-Arg(di-Z)-OH is coupled via the mixed anhydride (MA) with HGlu(OBzl)-Lys(Z)-Arg(Z,Z)-CH2Cl .
|
-
-
- HY-W011075
-
-
-
- HY-W021482
-
-
-
- HY-W048199
-
-
-
- HY-W022255
-
|
D-Fmoc-glutamic acid
|
Amino Acid Derivatives
|
Others
|
|
Fmoc-D-Glu-OH (D-Fmoc-glutamic acid) is a derivative of glutamate, can be used to prepare supramolecular hydrogels .
|
-
- HY-W008326
-
-
- HY-W012000
-
|
Boc-N-Me-Ile-OH
|
Amino Acid Derivatives
|
Others
|
|
Boc-N-methyl-L-isoleucine (Boc-N-Me-Ile-OH) is a peptide products and can be used as a precursor in organic synthesis and pharmaceuticals .
|
-
- HY-W042005
-
|
|
Amino Acid Derivatives
|
Others
|
|
H-D-Phe(3,4-DiCl)-OH is D-3,4-Dichlorophenylalanine, a amino acid derivative. H-D-Phe(3,4-DiCl)-OH shows protein synthesis activity .
|
-
- HY-W048700
-
-
- HY-W041076
-
-
- HY-W050025
-
-
- HY-Y1636
-
|
|
Amino Acid Derivatives
|
Others
|
|
Fmoc-Arg(Pbf)-OH is an arginine derivative containing amine protecting group Fmoc. Fmoc-Arg(Pbf)-OH is a building block for the introduction of Arg into SPPS (Solid-Phase Peptide Synthesis) .
|
-
- HY-W048209
-
|
|
Amino Acid Derivatives
|
Others
|
|
Fmoc-Lys(Palmitoyl)-OH is a Fmoc-amino acid with long alkyl chains. Fmoc-Lys(Palmitoyl)-OH can be used for peptide synthesis .
|
-
- HY-W039102
-
|
|
Amino Acid Derivatives
|
Cancer
|
|
N-Fmoc-N,O-dimethyl-L-serine is a serine derivative that can be used for coibamide A synthesis. Coibamide A is a marine natural product with potent antiproliferative activity against human cancer cells .
|
-
- HY-W061614
-
|
|
Amino Acid Derivatives
|
Others
|
|
(4R)-1-Boc-4-fluoro-D-proline is an amino acid derivative that can be used for preparation of peptidomimetics, dihydropyridopyrimidines and pyridopyrimidines .
|
-
- HY-W074914
-
-
- HY-W013726
-
-
- HY-W019205
-
-
- HY-35028
-
|
|
Amino Acid Derivatives
|
Others
|
|
Boc-Glu-Ofm is a peptide. Boc-Glu-Ofm has been used for the synthesis of ester insulin and cyclic peptide mixtures .
|
-
- HY-75332
-
|
D-Cbz phenylglycine
|
Amino Acid Derivatives
|
Others
|
|
Z-D-Phg-OH (D-Cbz phenylglycine) is a N-blocked amino acids with Kd values of 390 μM and 323 μM for tBuCQN and tBuCQD, respectively .
|
-
- HY-W048332
-
-
- HY-W039112
-
-
- HY-79709
-
|
|
Amino Acid Derivatives
|
Others
|
|
N-(Methoxycarbonyl)-D-valine methyl ester is an amino acid derivative that can be used for compound synthesis .
|
-
- HY-77635
-
-
- HY-W007223
-
|
D-5-HTP; 5-Hydroxy-D-tryptophan
|
Others
5-HT Receptor
|
Neurological Disease
|
|
D-5-Hydroxytryptophan (D-5-HTP) is the D-isomer of 5-HTP and can be isolated from DL-5-hydroxytryptophan by continuous separation. Compared with intraperitoneal administration of L-5-Hydroxytryptophan, which can induce dose-dependent backward walking behavior in mice, D-5-Hydroxytryptophan has no significant effect on mouse behavior and is a negative control. D-5-Hydroxytryptophan is also a 5-HT ligand, capable of binding to the 5-HT site with affinity in the micromolar range .
|
-
- HY-20897A
-
-
- HY-60265
-
-
- HY-W013152
-
-
- HY-W016424
-
-
- HY-W048825
-
|
|
Amino Acid Derivatives
|
Others
|
|
Fmoc-Ala-Ala-OH (3) is a self-assemble fluorenylmethoxycarbonyl-dipeptide, which is a smaller amphiphilic building blocks consists dipeptides linked to fluore nylmethoxycarbonyl (Fmoc). Fmoc-Ala-Ala-OH can be used as scaffold materials in 3D cell culture .
|
-
- HY-W048830
-
-
- HY-W141810
-
|
H-Phe(4-NH2)-OH hydrochloride
|
Endogenous Metabolite
|
Others
|
|
4-Amino-L-phenylalanine (H-Phe(4-NH2)-OH) hydrochloride is an endogenous metabolite.
|
-
- HY-113084
-
|
|
iGluR
Endogenous Metabolite
|
Neurological Disease
|
|
L-Cysteine S-sulfate is a potent N-methyl-d-aspartate (NMDA) glutamatergic receptor agonist. L-Cysteine S-sulfate is the substrate for cystine lyase, and can be used in mass spectrometry operations .
|
-
- HY-119543
-
|
|
Amino Acid Derivatives
|
Others
|
|
O-Succinyl-L-homoserine is a homoserine derivative. O-Succinyl-L-homoserine is an intermediate in the biosynthesis of methionine in Escherichia coli and Salmonella typhimurium .
|
-
- HY-41121
-
|
Boc-Ala-OH
|
Amino Acid Derivatives
|
Others
|
|
Boc-L-Ala-OH (Boc-Ala-OH) shows excellent affinity with ATP. Boc-L-Ala-OH contains an amino acid moiety, and an acylamide bond like that of the peptide and protein .
|
-
- HY-W002299
-
|
Boc-D-Leu-OH hydrate
|
Amino Acid Derivatives
|
Neurological Disease
|
|
Boc-D-Leucine monohydrate (Boc-D-Leu-OH hydrate) is an N-Boc-protected form of D-Leucine (L330150). D-Leucine is an unnatural isomer of L-Leucine (L330110) that acts as an auto-inhibitor of lactic streptococci. D-Leucine shows potent anti-seizure effect .
|
-
- HY-W005308
-
|
|
Amino Acid Derivatives
|
Cancer
|
|
N-BOC-DL-serine methyl ester is a Serine derivative. N-BOC-DL-serine methyl ester is used for the synthesis of α,β-dehydro-α-amino acid. N-BOC-DL-serine methyl ester is also used for the synthesis of anti-cancer agent, such as quinazolinone derivative that inhibits PI3K activity, and tricyclic pyrolopyranopyridines that inhibits protein kinase activity .
|
-
- HY-W010712
-
|
|
Amino Acid Derivatives
|
Others
|
|
Fmoc-His(Trt)-OH has trityl (Trt) group to protect the side-chain of His. Fmoc-His(Trt)-OH has Fmoc group to protect -αNH2. Fmoc-His(Trt)-OH can be used for solid phase synthesis of peptides, providing protection against racemization and by-product formation .
|
-
- HY-W010955
-
|
NSC 334018
|
Biochemical Assay Reagents
|
Others
|
|
Z-Phe-Leu-OH (NSC 334018) is a substrate for carboxypeptidase Y (CPY). Z-Phe-Leu-OH is incubated with recombinant CPY to determine peptidase activity .
|
-
- HY-W012159
-
|
H-MET-SER-OH
|
Angiotensin-converting Enzyme (ACE)
|
Cardiovascular Disease
|
|
Methionylserine (H-MET-SER-OH) is a methionine- and serine-containing dipeptide. Methionylserine binds to and translocation via intestinal di/tri-peptide transporter 1 (hPEPT1) with a Km value of 0.2 mM. Methionylserine inhibits ACE enzyme activity. Methionylserine can be used in the research of hypension .
|
-
- HY-W013123
-
|
|
Amino Acid Derivatives
|
Others
|
|
Fmoc-D-Phe(4-CF3)-OH is Phenylalanine derivative. Fmoc-D-Phe(4-CF3)-OH can be used for the research of peptide inhibitors of protein-protein interactions .
|
-
- HY-W022657
-
|
|
Amino Acid Derivatives
|
Others
|
|
H-Met-OiPr hydrochloride is an Methionine derivative. H-Met-OiPr hydrochloride participates in the synthesis preparation of inhibitors of farnesyl-protein transferase (FTase), and can be used in cancer research .
|
-
- HY-W036160
-
|
|
Amino Acid Derivatives
|
Others
|
|
N-Fmoc-O-ethyl-L-homoserine is an homoserine derivative, can be used in cyclic peptide compounds synthesis, as a reducing reagent .
|
-
- HY-W039756
-
|
NSC 334362
|
Amino Acid Derivatives
|
Others
|
|
Boc-Ala-Ala-OH (NSC 334362) is an Alanine derivative. Boc-Ala-Ala-OH is used in the preparation of anti-bacterial agent .
|
-
- HY-W141881
-
|
|
Biochemical Assay Reagents
|
Others
|
|
N-lauroylsarcosine is an anionic surfactant, and can be used as a permeation enhancer. The mixture of N-lauroylsarcosine in 25-50% ethanol acts synergistically to increase skin permeability, which may be useful for transdermal drug delivery research .
|
-
- HY-W015424
-
-
- HY-W041983
-
-
- HY-76317
-
|
N-Cbz-DL-proline; DL-Cbz-Proline
|
Amino Acid Derivatives
|
Others
|
|
Z-DL-Pro-OH (N-Cbz-DL-proline) is a proline derivative, can be used for the synthesis of agents or other compounds .
|
-
- HY-W010873
-
-
- HY-W008922
-
-
- HY-W016330
-
-
- HY-W015450
-
|
|
Endogenous Metabolite
|
Others
|
|
D-Ala-D-Ala constitutes the terminus of the peptide part of the peptidoglycan monomer unit and is involved in the transpeptidation reaction as the substrate. D-Ala-D-Ala is catalyzed by D-Alanine-D-Alanine ligase. D-Ala-D-Ala is a bacterial endogenous metabolite .
|
-
- HY-W142092
-
|
|
Bacterial
|
Others
|
|
N-Acetyl-DL-serine is a hydrophobic amino acid that is synthesized in the body and can be found as a free form or as a salt with malonate, phosphate, or acetate. N-Acetyl-DL-serine has antimicrobial activity against Bacillus cereus and Staphylococcus aureus. N-Acetyl-DL-serine has also been used for the immobilization of DNA fragments on solid surfaces and can be used for protein synthesis and optical detection of DNA strands .
|
-
- HY-W065053
-
|
|
Amino Acid Derivatives
|
Others
|
|
trans-N-Methyl-4-methoxyproline is a natural product that can be isolated from the stems of Petiveria alliacea and is also a Proline derivative .
|
-
- HY-42709
-
-
- HY-W048829
-
|
|
Amino Acid Derivatives
|
Others
|
|
Boc-Phe-Gly-OH is a Boc-protected phenylalanyl glycine derivative, can be used for the synthesis of agents or other compounds .
|
-
- HY-W052227
-
-
- HY-W048205
-
|
|
Amino Acid Derivatives
|
Others
|
|
N6-Diazo-L-Fmoc-lysine is an active compand and can be used in a variety of chemical studies. N6-Diazo-L-Fmoc-lysine is a click chemistry reagent, it contains an Azide group and can undergo copper-catalyzed azide-alkyne cycloaddition reaction (CuAAc) with molecules containing Alkyne groups. Strain-promoted alkyne-azide cycloaddition (SPAAC) can also occur with molecules containing DBCO or BCN groups.
|
-
- HY-W037451
-
|
|
Amino Acid Derivatives
|
Others
|
|
Methyl L-leucinate, methyl ester of L-leucine, is an alpha-amino acid ester. Methyl L-leucinate is a derivative of methyl ester and L-leucine, a class of compounds containing both amino and carboxyl groups in the molecule .
|
-
- HY-W011458
-
|
|
Amino Acid Derivatives
|
Others
|
|
3,5-Dinitro-L-tyrosine sodium is a tyrosine derivative. 3,5-Dinitro-L-tyrosine sodium as artificial substrate, has zero activity relative to tyrosine as a substrate for tyrosine aminotransferase .
|
-
- HY-W048674
-
|
Fmoc-O-acetyl-L-serine
|
Amino Acid Derivatives
|
Infection
|
|
Fmoc-Ser(Ac)-OH (Fmoc-O-acetyl-L-serine) is a Serine derivative. Fmoc-Ser(Ac)-OH can be used for the preparation of broad-spectrum coronavirus membrane fusion inhibitor .
|
-
- HY-W048671
-
|
|
Amino Acid Derivatives
|
Others
|
|
Fmoc-Thr(TBDMS)-OH is a Threonine derivative. Fmoc-Thr(TBDMS)-OH can be used for the preparation of sugar ligand-tethered functional nucleic acid conjugates for targeted research .
|
-
- HY-W091734
-
|
|
Amino Acid Derivatives
|
Cardiovascular Disease
Neurological Disease
|
|
Methyl 4-iodo-L-phenylalaninate hydrochloride is a Phenylalaninate derivative. Methyl 4-iodo-L-phenylalaninate hydrochloride can be used for the preparation of factor XI modulators used in the research of thrombotic and thromboembolic. Methyl 4-iodo-L-phenylalaninate hydrochloride can also be used for the synthesis of compounds for the research of amyloid-related diseases, such as Alzheimer’s disease .
|
-
- HY-W007052
-
-
- HY-130189
-
|
|
Drug Metabolite
|
Others
|
|
S-Phenylmercapturic acid, a metabolite of benzene, can be used as a biomarker, identified by GC, HPLC (UV or fluorescence detection), GC-MS, LC-MS/MS or immunoassay .
|
-
- HY-W041988
-
|
|
Bacterial
|
Infection
|
|
Fmoc-Glu-OMe, a glutamic acid derivative, shows antibacterial activity and gelation property in AgNO3 solution. Fmoc-Glu-OMe is a mouldable wound healing biomaterial .
|
-
- HY-W009912
-
|
|
Amino Acid Derivatives
|
Others
|
|
H-Tyr(Me)-OH is a synthetic amino acid, and can enter into protein in E. coli in response to an amber nonsense codon .
|
-
- HY-W003605A
-
|
|
Amino Acid Derivatives
|
Others
|
|
1-Boc-DL-Pyroglutamic acid ethyl ester is a Boc-protected Pyroglutamic acid derivative, can be used for the synthesis of agents or other compounds .
|
-
- HY-W142161
-
|
Fmoc-MeHis(Trt)-OH
|
Amino Acid Derivatives
|
Others
|
|
Fmoc-N-Me-His(Trt)-OH (Fmoc-MeHis(Trt)-OH) is a is an amino acid derivative containing amino and carboxyl groups. Fmoc-N-Me-His(Trt)-OH for the synthesis of Fmoc-MeHis (Trt) -Leu-OH .
|
-
- HY-W142073
-
|
7-Methyltryptophan
|
Amino Acid Derivatives
|
Infection
|
|
7-Methyl-DL-tryptophan (7-Methyltryptophan) is an amino acid derivative, which is a key precursor for biosynthesis of many non-ribosomal peptide antibiotics. 7-Methyl-DL-tryptophan plays an important role in synthesis of high-efficiency antibacterial agents and analogues thereof .
|
-
- HY-W016012
-
|
|
Amino Acid Derivatives
|
Others
|
|
Glu-Glu is a glutamic acid derivative containing amino and carboxyl groups. Glu-Glu is an analogs of acidic tripeptide and can contribute to calcium absorption .
|
-
- HY-107663
-
|
Pro-Leu-Gly-NH2; Melanostatin
|
Dopamine Receptor
|
Neurological Disease
|
|
MIF-1 (Melanostatin), an endogenous brain peptide, is a potent dopamine receptor allosteric modulator. MIF-1 inhibits melanin formation. MIF-1 blocks the effects of opioid receptor activation to modulate the analgesic effects. MIF-1 accesses from the blood to the CNS by directly crossing the blood-brain barrier (BBB) .
|
-
- HY-W142140
-
|
N-Methylvaline
|
Amino Acid Derivatives
|
Others
|
|
N-Methyl-DL-valine is a valine derivant, is metabolized to cysteine, alanine, tyrosine, tryptophan, citric acid, and succinic acid in the sprout. N-Methyl-DL-valine involves in the modification of monomethyl auristatin F (MMAF), an anti-tubulin agent, makes it hydrophobic functionalization and increases cell permeability .
|
-
- HY-W111226
-
|
|
Amyloid-β
Amino Acid Derivatives
|
Cardiovascular Disease
|
|
Fmoc-His(3-Me)OH derives Histidine-associating compounds with biological activity. Fmoc-His(3-Me)OH, with Fmoc-citrulline-OH, Fmoc-His(1-Me)-OH together, forms tri-peptides and shows vasodilating effect with EC50s of 2.7-4.7 mM in 1.0 mM Phenylephrine (PE)-contracted aorta rings. Fmoc-His(3-Me)OH (resin) also makes Methyl-His-Gly-Lys (His(3-Me)-Gly-Lys), thus acts as an [Ca 2+]i inhibitor. Fmoc-His(3-Me)OH methylates NAHIS02, making it unable to block the Alzheimer's Aβ channel .
|
-
- HY-W072147
-
|
Fmoc-L-Ser-OMe
|
Amino Acid Derivatives
|
Others
|
|
Fmoc-Ser-OMe (Fmoc-L-Ser-OMe) is a hydroxylated L-amino acid protected with a 9-fluorenylmethyloxycarbonyl (Fmoc) group. Fmoc-Ser-OMe involves in chlorophyll–amino acid conjugates synthesis, and acts as a chromo/fluorophores modified protein and emits visible to near-infrared lights efficiently. Fmoc-Ser-OMe glycosylates and produces small mucin-related Olinked glycopeptides, as an alcohol acceptor .
|
-
- HY-W109513
-
|
|
Amino Acid Derivatives
|
Inflammation/Immunology
|
|
Boc-Lys(Z)-OH (DCHA) is a involves in synthesis thymosin β4, βg and β6 fragments, and increases E-rosette forming capacity in Lupus Nephritis model. Boc-Lys(Z)-OH (DCHA) involves in synthesis Boc-Lyz-OCH3 and acts as a reagent of peptidyl thrombin inhibitors production .
|
-
- HY-148031
-
|
|
ADC Linker
|
Others
|
|
MC-Ala-Ala-Asn-PAB-PNP is a peptide, can be used to synthesize specifically activated micromolecular target coupling body .
|
-
- HY-W013190
-
-
- HY-W015230
-
-
- HY-W008997
-
-
- HY-W008999
-
-
- HY-W009003
-
-
- HY-W009005
-
-
- HY-W009006
-
-
- HY-W009008
-
-
- HY-W009023
-
-
- HY-W009038
-
-
- HY-W009049
-
-
- HY-W009085
-
-
- HY-W009088
-
-
- HY-104004A
-
|
Fmoc-Ser-(GalNAc(Ac)3-beta-D)-OH; Fmoc-Ser[GalNAc(Ac)3-β-D]-OH; Fmoc-Ser(Ac3AcNH-β-Gal)-OH
|
Amino Acid Derivatives
|
Others
|
|
Fmoc-Ser(O-β-D-GalNAc(OAc)3)-OH is a serine derivative .
|
-
- HY-W009117
-
-
- HY-107848
-
-
- HY-W009124
-
-
- HY-113014
-
-
- HY-W009144
-
-
- HY-113214
-
-
- HY-W067091
-
-
- HY-W009197
-
-
- HY-W009211
-
-
- HY-118349
-
-
- HY-W009257
-
-
- HY-W009258
-
-
- HY-122526
-
-
- HY-W009260
-
-
- HY-128675
-
-
- HY-W009284
-
-
- HY-W009320
-
-
- HY-131894
-
-
- HY-W068839
-
-
- HY-134449
-
-
- HY-134450
-
-
- HY-W009328
-
-
- HY-134852
-
-
- HY-134935
-
-
- HY-W009337
-
-
- HY-135113
-
|
|
Amino Acid Derivatives
|
Others
|
|
Lanthionine is a cysteine derivative. Lanthionine is linked by a disulfide bond formed by an oxidation reaction between two cysteine residues .
|
-
- HY-137950
-
-
- HY-W009345
-
-
- HY-139128
-
-
- HY-W088097
-
-
- HY-W009381
-
-
- HY-W089229
-
-
- HY-15400
-
-
- HY-W092107
-
-
- HY-W009403
-
-
- HY-20153
-
-
- HY-20165
-
-
- HY-W097163
-
-
- HY-W009502
-
-
- HY-W098060
-
-
- HY-20561A
-
-
- HY-W009535
-
-
- HY-W099247
-
-
- HY-W009562
-
-
- HY-W014373
-
-
- HY-W009592A
-
-
- HY-W014375
-
-
- HY-20838B
-
-
- HY-20861
-
-
- HY-W014406
-
-
- HY-W102709
-
-
- HY-22296
-
-
- HY-W014505
-
-
- HY-W111209
-
-
- HY-W014599
-
-
- HY-23053
-
-
- HY-W111214
-
-
- HY-23122
-
-
- HY-W014742
-
-
- HY-W111969
-
-
- HY-W014786
-
-
- HY-23185
-
-
- HY-W014824
-
-
- HY-23424
-
-
- HY-W014916
-
-
- HY-W014917
-
-
- HY-W014919
-
-
- HY-W125501
-
-
![(2R)-2-[(3,5-Dinitrobenzoyl)<em>amino</em>]-2-phenyl-acetic acid](//file.medchemexpress.com/product_pic/hy-w125501.gif)
- HY-W015177
-
-
- HY-30231
-
-
- HY-30232
-
-
- HY-W015231
-
-
- HY-W015233
-
-
- HY-32688
-
-
- HY-W128408
-
-
- HY-W015425
-
-
- HY-W129448
-
-
- HY-W129585
-
-
- HY-W130212
-
|
|
Amino Acid Derivatives
|
Others
|
|
(R)-2-((((9H-Fluoren-9-yl)methoxy)carbonyl)amino)-3-(2-(trifluoromethyl)phenyl)propanoic acid is a phenylalanine derivative .
|
-
- HY-W015651
-
-
- HY-W015926
-
-
- HY-W015946
-
-
- HY-W140881
-
-
- HY-W016018
-
-
- HY-W016031
-
-
- HY-W016075
-
-
- HY-41650
-
|
(S)-2-((tert-Butoxycarbonyl)amino)-N-methoxy-N-methylpropanamide; (S)-2-(tert-Butoxycarbonylamino)-N-methoxy-N-methylpropionamide
|
Amino Acid Derivatives
|
Others
|
|
Boc-Ala-NMe(OMe) is an alanine derivative .
|
-
- HY-W141779
-
-
- HY-W016319
-
-
- HY-W016336
-
-
- HY-42065
-
-
- HY-W141786
-
-
- HY-42069
-
-
- HY-W016425
-
-
- HY-42356
-
-
- HY-42364
-
-
- HY-42448
-
-
- HY-W016547
-
-
- HY-42757B
-
-
- HY-42938
-
-
- HY-W016552
-
-
- HY-42994
-
-
- HY-43459
-
-
- HY-W016555
-
-
- HY-43973
-
-
- HY-W016716
-
-
- HY-44070
-
-
- HY-W016731
-
-
- HY-59121
-
-
- HY-W016749
-
-
- HY-59135
-
-
- HY-W016948
-
-
- HY-59140
-
-
- HY-59260
-
-
- HY-60256
-
-
- HY-66024
-
-
- HY-W017202
-
-
- HY-W017254
-
-
- HY-75331
-
-
- HY-W017256
-
-
- HY-W009631
-
-
- HY-W017350
-
-
- HY-75401
-
-
- HY-W017404
-
-
- HY-75853
-
-
- HY-W009686
-
-
- HY-W017413
-
-
- HY-75947
-
-
- HY-W009770
-
-
- HY-76448
-
-
- HY-W009794
-
-
- HY-76962
-
-
- HY-W017788
-
-
- HY-77021
-
-
- HY-W009908
-
-
- HY-77132
-
-
- HY-W018077
-
-
- HY-W009913
-
-
- HY-W018238
-
-
- HY-W010028
-
-
- HY-W018366
-
-
- HY-W010077
-
-
- HY-W010156
-
-
- HY-W018489
-
-
- HY-W010197
-
-
- HY-77802
-
-
- HY-W018628
-
-
- HY-W010276
-
-
- HY-78105
-
-
acetic acid](//file.medchemexpress.com/product_pic/hy-78105.gif)
- HY-W010277
-
-
- HY-W018741
-
-
- HY-W010324
-
-
- HY-W010366
-
-
- HY-W018865
-
|
(S)-Cysteine methyl ester hydrochloride; Methyl D-cysteinate hydrochloride
|
Amino Acid Derivatives
|
Others
|
|
Methyl D-cysteinate hydrochloride is a cysteine derivative .
|
-
- HY-78746A
-
|
|
Amino Acid Derivatives
|
Others
|
|
D-Proline, 3-(3-chloro-2-fluorophenyl)-4-(4-chloro-2-fluorophenyl)-4-cyano-5-(2,2-dimethylpropyl)-, (3S,4R,5S)-rel- is a proline derivative .
|
-
- HY-W010590
-
-
- HY-78897
-
-
- HY-W010591
-
-
- HY-W019684
-
-
- HY-W019714
-
-
- HY-W010714
-
-
- HY-W021299
-
-
- HY-W010719
-
-
- HY-79123
-
-
- HY-W010721
-
-
- HY-W021790
-
-
- HY-79130
-
|
Benzeneacetic acid, α-[[(9H-fluoren-9-ylmethoxy)carbonyl]amino]-, (S)-; (S)-2-[[[(9H-Fluoren-9-yl)methoxy]carbonyl]amino]phenylethanoic acid; (S)-N-Fmoc-α-phenylglycine; N-9-Fluorenylmethoxycarbonyl-L-phenylglycine
|
Amino Acid Derivatives
|
Others
|
|
Fmoc-(S)-phenylglycine is a Glycine (HY-Y0966) derivative .
|
-
- HY-79132
-
-
- HY-79271
-
|
Butanamide, 2-amino-N,3,3-trimethyl-, (S)-; (S)-2-amino-N-methyl-3,3-dimethylbutanamide; L-tert-Leucine methylamide; L-tert-Leucine-N-methylamide
|
Amino Acid Derivatives
|
Others
|
|
S-tert-Leucine N-methylamide is a leucine derivative .
|
-
- HY-W010747
-
-
- HY-79288
-
|
(S)-2-[(tert-Butoxycarbonyl)amino]-3-(3-fluorophenyl)propionic acid; tert-Butoxycarbonyl-L-3-fluorophenylalanine
|
Amino Acid Derivatives
|
Others
|
|
(2S)-2-[(tert-Butoxycarbonyl)amino]-3-(3-fluorophenyl)propionic acid is a phenylalanine derivative .
|
-
![(2S)-2-[(tert-Butoxycarbonyl)<em>amino</em>]-3-(3-fluorophenyl)propionic acid](//file.medchemexpress.com/product_pic/hy-79288.gif)
- HY-W010758
-
-
- HY-W141852
-
-
- HY-79333
-
-
![L-Alanine, N-[(S)-(4-nitrophenoxy)phenoxyphosphinyl]-, 1-methylethyl ester](//file.medchemexpress.com/product_pic/hy-79333.gif)
- HY-79404
-
|
L-Leucine, N-[(1,1-dimethylethoxy)carbonyl]-4-methyl- (9CI); (S)-2-(tert-Butoxycarbonylamino)-4,4-dimethylpentanoic acid
|
Amino Acid Derivatives
|
Others
|
|
N-(Tert-Butoxycarbonyl)-L-neopentylglycine is a Glycine (HY-Y0966) derivative .
|
-
- HY-W010782
-
-
- HY-79415
-
-
- HY-79417
-
|
Carbamic acid, [(1S)-1-[(methoxymethylamino)carbonyl]-3-methylbutyl]-, 1,1-dimethylethyl ester (9CI); Carbamic acid, [1-[(methoxymethylamino)carbonyl]-3-methylbutyl]-, 1,1-dimethylethyl ester, (S)-
|
Amino Acid Derivatives
|
Others
|
|
(S)-N-Methyl-N-methoxy-2-(tert-butoxycarbonylamino)-4-methylpentanamide is a leucine derivative .
|
-
- HY-W010788
-
-
- HY-W010793
-
-
- HY-79680
-
|
|
Amino Acid Derivatives
|
Others
|
|
(S)-2-(tert-butoxycarbonylamino)-3-(4-carbamoyl-2,6-dimethylphenyl)propanoic acid is a phenylalanine derivative .
|
-
- HY-79708A
-
|
Methyl (R)-2-amino-3-methylbutanoate hydrochloride; Methyl D-valinate hydrochloride; NSC 22921
|
Amino Acid Derivatives
|
Others
|
|
O-Methyl-D-valine (hydrochloride) is a valine derivative .
|
-
- HY-79877
-
-
- HY-W010825
-
-
- HY-79919
-
|
|
Amino Acid Derivatives
|
Others
|
|
D-Phenylalanine, N-[N-[(1,1-dimethylethoxy)carbonyl]-D-leucyl]-, phenylmethyl ester is a phenylalanine derivative .
|
-
![D-Phenylalanine, N-[N-[(1,1-dimethylethoxy)carbonyl]-D-leucyl]-, phenylmethyl ester](//file.medchemexpress.com/product_pic/hy-79919.gif)
- HY-W010837
-
-
- HY-I0102
-
|
|
Amino Acid Derivatives
|
Others
|
|
(2S)-Methyl 2-(2-cyclohexyl-2-(pyrazine-2-carboxamido)acetamido)-3,3-dimethylbutanoate is a valine derivative .
|
-
- HY-W141889
-
-
- HY-I0109
-
-
- HY-I0115
-
|
|
Amino Acid Derivatives
|
Others
|
|
(S)-2-((S)-2-Cyclohexyl-2-(pyrazine-2-carboxamido)acetamido)-3,3-dimethylbutanoic acid is a valine derivative .
|
-
- HY-I0124
-
-
- HY-W141893
-
-
- HY-I0172
-
-
- HY-W010888
-
-
- HY-W141899
-
-
- HY-I0393
-
-
- HY-W010894
-
-
- HY-W010895
-
-
- HY-I0517
-
-
- HY-I0519
-
-
- HY-I0591
-
-
- HY-W010913
-
-
- HY-I0630
-
-
- HY-W010924
-
-
- HY-I0749A
-
|
|
Amino Acid Derivatives
|
Others
|
|
(S)-Methyl 2-((S)-2-((S)-2-amino-4-phenylbutanamido)-4-methylpentanamido)-3-phenylpropanoate 2,2,2-trifluoroacetate is a phenylalanine derivative .
|
-
- HY-I0775
-
|
|
Amino Acid Derivatives
|
Others
|
|
(S)-methyl 2-((S)-4-methyl-2-((S)-2-(2-morpholinoacetamido)-4-phenylbutanamido)pentanamido)-3-phenylpropanoate is a phenylalanine derivative .
|
-
- HY-W141910
-
-
- HY-I0917
-
-
- HY-W141911
-
-
- HY-I0924
-
-
- HY-W010957
-
-
- HY-I0924A
-
|
Methyl (R)-phenylalaninate hydrochloride; Methyl D-phenylalaninate hydrochloride
|
Amino Acid Derivatives
|
Others
|
|
D-Phe-OMe monohydrochloride is a phenylalanine derivative .
|
-
- HY-W010958
-
|
|
Amino Acid Derivatives
|
Others
|
|
(S)-2-((((9H-Fluoren-9-yl)methoxy)carbonyl)amino)-3-(3-cyanophenyl)propanoic acid is a phenylalanine derivative .
|
-
- HY-I1044
-
-
- HY-I1107
-
-
- HY-W141919
-
-
- HY-N2378
-
|
Benzenepropanoic acid, β-amino-α-hydroxy-, hydrochloride, (αR,βS)-
|
Amino Acid Derivatives
|
Others
|
|
(2R,3S)-3-Phenylisoserine hydrochloride is a serine derivative .
|
-
- HY-W141922
-
-
- HY-W000795
-
-
- HY-W000830
-
-
- HY-W141927
-
-
- HY-W000843
-
-
- HY-W141928
-
-
- HY-W001037
-
-
- HY-W141930
-
-
- HY-W141933
-
-
- HY-W141934
-
-
- HY-W001954
-
-
- HY-W002074
-
-
- HY-W002169
-
-
- HY-W002170
-
-
- HY-W002173
-
-
- HY-W002176
-
-
- HY-W002235
-
-
- HY-W141936
-
-
- HY-W002237
-
-
- HY-W002300
-
-
- HY-W002301
-
|
|
Amino Acid Derivatives
|
Others
|
|
(2S)-4-(benzyloxy)-2-{[(9H-fluoren-9-ylmethoxy)carbonyl]amino}-4-oxobutanoic acid is an aspartic acid derivative .
|
-
![(2S)-4-(benzyloxy)-2-{[(9H-fluoren-9-ylmethoxy)carbonyl]<em>amino</em>}-4-oxobutanoic acid](//file.medchemexpress.com/product_pic/hy-w002301.gif)
- HY-W002302
-
-
- HY-W002303
-
-
- HY-W002336
-
-
- HY-W141946
-
-
- HY-W022134
-
-
![N-[(9H-fluoren-9-ylmethoxy)carbonyl]-N-methylalanine](//file.medchemexpress.com/product_pic/hy-w022134.gif)
- HY-W022137
-
-
- HY-W002449
-
-
- HY-W002481
-
-
- HY-W002519
-
-
- HY-W022223
-
-
- HY-W002578
-
-
- HY-W002588
-
-
- HY-W022228
-
-
![N-[(9H-Fluoren-9-ylmethoxy)carbonyl]-3-methoxy-L-phenylalanine](//file.medchemexpress.com/product_pic/hy-w022228.gif)
- HY-W003225
-
-
- HY-W141960
-
-
- HY-W003985
-
-
- HY-W141962
-
-
- HY-W141963
-
-
- HY-W004063
-
-
- HY-W004064
-
-
- HY-W004083
-
-
- HY-W022281
-
-
- HY-W004861
-
-
- HY-W022405
-
-
- HY-W005014
-
-
- HY-W005117
-
-
- HY-W022444
-
-
- HY-W005143
-
-
- HY-W005144
-
-
- HY-W022471
-
-
- HY-W022536
-
-
- HY-W005720
-
-
- HY-W005759
-
-
- HY-W005815
-
-
- HY-W022630
-
-
- HY-W005883
-
-
- HY-W141985
-
-
- HY-W022823
-
-
- HY-W005891
-
-
- HY-W023145
-
-
- HY-W141987
-
-
- HY-W023493
-
|
2-aminopent-4-enoic acid
|
Amino Acid Derivatives
|
Neurological Disease
|
|
DL-Allylglycine (2-Aminopent-4-enoic acid) is a glutamate decarboxylase (GAD) inhibitor. DL-Allylglycine has convulsant activity that can be used in studies to induce epileptic seizures .
|
-
- HY-W024554
-
-
- HY-W006062
-
-
- HY-W025807
-
-
- HY-W141990
-
-
- HY-W006152
-
-
- HY-W026072
-
-
- HY-W006185
-
-
- HY-W026894
-
-
- HY-W142000
-
-
- HY-W027230
-
-
![N-[4-(Morpholin-4-ylsulfonyl)benzoyl]glycine](//file.medchemexpress.com/product_pic/hy-w027230.gif)
- HY-W142003
-
-
- HY-W142008
-
-
- HY-W142009
-
-
- HY-W007020
-
-
- HY-W007108
-
-
- HY-W007136
-
-
- HY-W142019
-
-
- HY-W007399
-
-
- HY-W007408
-
-
- HY-W007573
-
-
- HY-W142023
-
-
- HY-W007578
-
-
- HY-W007615
-
-
- HY-W007706
-
-
- HY-W007720
-
-
- HY-W007722A
-
-
- HY-W007750
-
-
- HY-W007766
-
-
- HY-W142035
-
-
- HY-W007842
-
-
- HY-W007941
-
-
- HY-W008016
-
-
- HY-W142044
-
-
- HY-W008028
-
-
- HY-W008029
-
-
- HY-W008061
-
-
- HY-W008072
-
-
- HY-W008077
-
-
- HY-W008086
-
-
- HY-W008113
-
-
- HY-W008134
-
-
- HY-W032681
-
-
- HY-W032689
-
-
- HY-W142062
-
|
|
Amino Acid Derivatives
|
Others
|
|
cis-Fmoc-Pro(4-N3)-OH is a proline derivative . cis-Fmoc-Pro(4-N3)-OH is a click chemistry reagent, it contains an Azide group and can undergo copper-catalyzed azide-alkyne cycloaddition reaction (CuAAc) with molecules containing Alkyne groups. Strain-promoted alkyne-azide cycloaddition (SPAAC) can also occur with molecules containing DBCO or BCN groups.
|
-
- HY-W035914
-
-
- HY-W008156
-
-
- HY-W142081
-
-
- HY-W008176
-
-
- HY-W008178
-
-
- HY-W008179
-
-
- HY-W008182
-
-
- HY-W008183
-
-
- HY-W008196
-
-
- HY-W036320
-
|
|
Amino Acid Derivatives
|
Others
|
|
N2-(((9H-Fluoren-9-yl)methoxy)carbonyl)-Nw-((4-methoxy-2,3,6-trimethylphenyl)sulfonyl)-N2-methyl-L-arginine is an arginine derivative .
|
-
- HY-W036329
-
-
- HY-W037120
-
|
|
Amino Acid Derivatives
|
Others
|
|
N-(((9H-Fluoren-9-yl)methoxy)carbonyl)-S-((4-methoxyphenyl)diphenylmethyl)-D-cysteine is a cysteine derivative .
|
-
- HY-W008219
-
-
- HY-W037441
-
-
- HY-W008233
-
-
- HY-W008255
-
-
- HY-W008261
-
-
- HY-W008269
-
-
- HY-W142107
-
-
- HY-W008297
-
-
- HY-W008308
-
-
- HY-W038873
-
-
- HY-W008353
-
-
- HY-W142111
-
-
- HY-W039180
-
-
- HY-W142113
-
-
- HY-W039449
-
-
- HY-W039758
-
-
- HY-W039759
-
-
- HY-W039763
-
-
- HY-W008359
-
-
- HY-W039947
-
-
![N6-[(2E)-1-Oxo-2-buten-1-yl]-L-lysine](//file.medchemexpress.com/product_pic/hy-w039947.gif)
- HY-W040067
-
-
- HY-W008383
-
-
- HY-W040124
-
|
|
Amino Acid Derivatives
|
Others
|
|
DL-Propargylglycine is a Glycine (HY-Y0966) derivative . DL-Propargylglycine is a click chemistry reagent, it contains an Alkyne group and can undergo copper-catalyzed azide-alkyne cycloaddition (CuAAc) with molecules containing Azide groups.
|
-
- HY-W142126
-
-
- HY-W040333
-
-
- HY-W008386
-
-
- HY-W008395
-
|
|
Amino Acid Derivatives
|
Others
|
|
Fmoc-D-Pra-OH is a Glycine (HY-Y0966) derivative . Fmoc-D-Pra-OH is a click chemistry reagent, it contains an Alkyne group and can undergo copper-catalyzed azide-alkyne cycloaddition (CuAAc) with molecules containing Azide groups.
|
-
- HY-W008432
-
-
- HY-W008446
-
|
|
Amino Acid Derivatives
|
Others
|
|
(2S,4R)-4-((((9H-Fluoren-9-yl)methoxy)carbonyl)amino)-1-(tert-butoxycarbonyl)pyrrolidine-2-carboxylic acid is a proline derivative .
|
-
- HY-W142133
-
-
- HY-W008467
-
-
- HY-W008475
-
-
- HY-W008486
-
-
- HY-W008487
-
-
- HY-W008489
-
-
- HY-W008495
-
-
- HY-W008522
-
-
- HY-W008527
-
-
- HY-W008544
-
-
- HY-W008549
-
-
- HY-W008560
-
-
- HY-W008599
-
|
|
Amino Acid Derivatives
|
Others
|
|
(S)-2-Amino-3-methyl-N-(4-methyl-2-oxo-2H-chromen-7-yl)butanamide 2,2,2-trifluoroacetate is a valine derivative .
|
-
- HY-W008633
-
-
- HY-W142151
-
-
- HY-W008667
-
|
|
Amino Acid Derivatives
|
Others
|
|
(S)-2-((((9H-Fluoren-9-yl)methoxy)carbonyl)amino)-5-(tert-butoxy)-5-oxopentanoic acid hydrate is a glutamic acid derivative .
|
-
- HY-W040416
-
-
- HY-W008685
-
-
- HY-W040438
-
-
- HY-W008688
-
-
- HY-W040441
-
-
- HY-W008694
-
-
- HY-W040686
-
-
- HY-W142163
-
-
- HY-W008696
-
-
- HY-W040801
-
-
- HY-W008731
-
-
- HY-W040803
-
-
- HY-W040804
-
-
- HY-W041857
-
-
- HY-W008787
-
-
- HY-W008800
-
-
- HY-W041864
-
-
- HY-W041866
-
-
- HY-W041867
-
-
- HY-W041982
-
-
- HY-W142171
-
-
- HY-W041986
-
-
- HY-W008866
-
-
- HY-WAA0253
-
-
- HY-W008867
-
-
- HY-W008869
-
-
- HY-Y0029
-
-
- HY-W008872
-
-
- HY-Y0134
-
|
|
Amino Acid Derivatives
|
Others
|
|
(S)-2-((((9H-fluoren-9-yl)methoxy)carbonyl)amino)-5-(tert-butoxy)-5-oxopentanoic acid is a glutamic acid derivative .
|
-
- HY-W041997
-
-
- HY-Y0168
-
-
- HY-W008887
-
-
- HY-W042001
-
-
- HY-W042002
-
-
- HY-W042006
-
-
- HY-W042008
-
-
- HY-Y0555
-
-
![N-[(Phenylmethoxy)carbonyl]-L-leucine](//file.medchemexpress.com/product_pic/hy-y0555.gif)
- HY-W008942
-
-
- HY-W042010
-
-
- HY-W008958
-
-
- HY-W042013
-
-
- HY-Y0749A
-
|
Glutamic acid, dimethyl ester, hydrochloride, D-
|
Amino Acid Derivatives
|
Others
|
|
Dimethyl D-glutamate hydrochloride is a glutamic acid derivative .
|
-
- HY-Y0920
-
-
- HY-W042057
-
-
- HY-Y1166
-
-
- HY-W008986
-
-
- HY-Y1413
-
-
- HY-W008996
-
-
- HY-Y1789
-
-
- HY-Y1801
-
|
L-Aspartic acid β-methyl ester hydrochloride
|
Amino Acid Derivatives
|
Others
|
|
β-Methyl L-aspartate hydrochloride is an aspartic acid derivative .
|
-
- HY-Y1856
-
-
- HY-Y1875
-
-
- HY-Z0291
-
|
Isopropyl L-alaninate; L-Alanine 2-propyl ester; L-Alanine isopropyl ester; O-Isopropyl-L-alanine
|
Amino Acid Derivatives
|
Others
|
|
L-Alanine isopropyl ester is an alanine derivative .
|
-
- HY-Z0711
-
-
- HY-Z0790
-
-
- HY-Y1661
-
-
- HY-W042016
-
-
- HY-W008995
-
-
- HY-W008981
-
-
- HY-W043473
-
-
- HY-W008972
-
-
- HY-W008971
-
-
- HY-W044573
-
-
- HY-W044620
-
-
- HY-W008926
-
-
- HY-W045221
-
-
- HY-W046352
-
-
- HY-Y0555A
-
|
N-(Benzyloxycarbonyl)-D-leucine; N-Carbobenzoxy-D-leucine; N-Carbobenzyloxy-D-leucine; NSC 523826
|
Amino Acid Derivatives
|
Others
|
|
D-N-(Benzyloxycarbonyl)leucine is a leucine derivative .
|
-
- HY-W047794
-
-
- HY-W008771
-
-
- HY-W047845
-
-
- HY-W047901
-
-
- HY-WAA0112
-
-
- HY-Y0007
-
|
L-Alanine, N-carboxy-, N-benzyl ester (6CI,7CI); (S)-2-(Benzyloxycarbonylamino)propanoic acid
|
Amino Acid Derivatives
|
Others
|
|
N-[(Benzyloxy)carbonyl]-L-alanine is an alanine derivative .
|
-
![N-[(Benzyloxy)carbonyl]-L-alanine](//file.medchemexpress.com/product_pic/hy-y0007.gif)
- HY-W048203
-
-
- HY-W048207
-
-
- HY-W048215
-
|
|
Amino Acid Derivatives
|
Others
|
|
N2-(((9H-Fluoren-9-yl)methoxy)carbonyl)-N6-(2-(7-methoxy-2-oxo-2H-chromen-4-yl)acetyl)-L-lysine is a lysine derivative .
|
-
- HY-W048217
-
-
- HY-W048283
-
-
- HY-W048286
-
-
- HY-W008426
-
-
- HY-W008389
-
-
- HY-W048677
-
-
- HY-W008382
-
-
- HY-W008273
-
-
- HY-W048691
-
-
- HY-W048693
-
-
- HY-W048701
-
-
- HY-W008256
-
-
- HY-W048703
-
-
- HY-W048704
-
|
|
Amino Acid Derivatives
|
Others
|
|
N2-(((9H-Fluoren-9-yl)methoxy)carbonyl)-N6-((4-methoxyphenyl)diphenylmethyl)-L-lysine is a lysine derivative .
|
-
- HY-W008079
-
-
- HY-W048708
-
-
- HY-W008075
-
-
- HY-107373A
-
-
- HY-W048727
-
-
- HY-W048828
-
-
- HY-W010959
-
-
- HY-W048831
-
-
- HY-W010962
-
-
- HY-W048839
-
-
- HY-W010964
-
-
- HY-W048911
-
-
- HY-W010965
-
-
- HY-W048918
-
-
- HY-W010982
-
-
- HY-W010997
-
-
- HY-W011000
-
-
- HY-W011001
-
-
- HY-W011003
-
-
- HY-W050494
-
-
- HY-W011019
-
-
- HY-W050785
-
-
- HY-W011026
-
-
- HY-W050803
-
-
- HY-W051093
-
-
- HY-W011033
-
-
- HY-W051350
-
-
- HY-W011049
-
-
- HY-W051418
-
-
- HY-W051568
-
-
- HY-W011056
-
-
- HY-W011064
-
-
- HY-W052212
-
-
- HY-W008908
-
-
- HY-W011074
-
-
- HY-W052246
-
-
- HY-W011081
-
-
- HY-W052309
-
-
- HY-W052310
-
-
- HY-W011088
-
-
- HY-W052493
-
-
- HY-W011089
-
-
- HY-W052529
-
-
- HY-W008371
-
-
- HY-W053503
-
|
|
Amino Acid Derivatives
|
Others
|
|
(S)-3-((tert-Butoxycarbonyl)amino)-3-(3-(trifluoromethyl)phenyl)propanoic acid is a phenylalanine derivative .
|
-
- HY-W053531
-
-
- HY-Y0028
-
|
N-(tert-Butoxycarbonyl)aspartic acid 1-benzyl ester; N-(tert-Butoxycarbonyl)aspartic acid benzyl ester
|
Amino Acid Derivatives
|
Others
|
|
(S)-2-(tert-Butoxycarbonylamino)succinic acid benzyl ester is an aspartic acid derivative .
|
-
- HY-79128
-
|
Fmoc-L-Lys(Boc)-OH; Fmoc-Lys(Boc)-OH; N-α-(Fmoc)-N-ε-(t-boc)-L-Lysine-OH
|
Amino Acid Derivatives
|
Others
|
|
Fmoc-L-Lys (Boc)-OH is a lysine derivative .
|
-
- HY-W011154
-
-
- HY-141526
-
-
- HY-W052408
-
-
- HY-W011167
-
-
- HY-W053705
-
-
- HY-W053801
-
-
- HY-W011199
-
-
- HY-W112057
-
-
- HY-W055811
-
-
- HY-W057434
-
-
- HY-W057465
-
-
- HY-W011203
-
-
- HY-W011210
-
|
|
Amino Acid Derivatives
|
Others
|
|
Fmoc-Pra-OH is a Glycine (HY-Y0966) derivative . Fmoc-Pra-OH is a click chemistry reagent, it contains an Alkyne group and can undergo copper-catalyzed azide-alkyne cycloaddition (CuAAc) with molecules containing Azide groups.
|
-
- HY-I1061
-
-
![L-Alloisoleucine, N-[(phenylmethoxy)carbonyl]-](//file.medchemexpress.com/product_pic/hy-i1061.gif)
- HY-W011218
-
-
- HY-I0125
-
-
- HY-W011223
-
|
|
Amino Acid Derivatives
|
Others
|
|
(S)-2-((tert-Butoxycarbonyl)amino)-3-(4-(trifluoromethyl)phenyl)propanoic acid is a phenylalanine derivative .
|
-
- HY-W011255
-
-
- HY-W062304
-
-
- HY-W061650
-
-
- HY-W011321
-
-
- HY-W011322
-
-
- HY-W063269
-
-
- HY-W011325
-
-
- HY-W011337
-
-
- HY-W011342
-
-
- HY-W011324
-
-
- HY-W011354
-
-
- HY-W011391A
-
-
- HY-W011423
-
-
- HY-W011443
-
-
- HY-W011444
-
-
- HY-W011472
-
-
- HY-W011488
-
-
- HY-W011537
-
-
- HY-W011553
-
-
- HY-W011567
-
-
- HY-W011606
-
-
- HY-W011652
-
-
- HY-W011686
-
-
- HY-W011701
-
-
- HY-W011703
-
-
- HY-W011713
-
-
- HY-W011722
-
-
- HY-W011773
-
-
- HY-W011778
-
-
- HY-77584
-
|
|
Amino Acid Derivatives
|
Others
|
|
(2S,4R)-1-((S)-2-((tert-butoxycarbonyl)amino)non-8-enoyl)-4-hydroxypyrrolidine-2-carboxylic acid is a proline derivative .
|
-
- HY-W011830
-
-
- HY-W011832
-
-
- HY-W011892
-
-
- HY-W011903
-
-
- HY-W011913
-
-
- HY-W011931
-
-
- HY-W011977
-
-
- HY-W011992
-
-
- HY-W011993
-
-
- HY-W012002
-
-
- HY-W012003
-
-
- HY-W012030
-
-
- HY-W012064
-
-
- HY-W012075
-
-
- HY-W012098
-
-
- HY-W012104
-
-
- HY-W012133
-
-
- HY-W012137
-
-
- HY-W012138
-
-
- HY-W012139
-
-
- HY-W012214
-
-
- HY-W012228
-
-
- HY-W012255
-
-
- HY-W012379
-
-
- HY-W012381
-
-
- HY-W012437
-
-
- HY-W012446
-
-
- HY-W012451
-
-
- HY-W012485
-
-
- HY-W012486
-
-
- HY-W012487
-
-
- HY-W012497
-
-
- HY-W012519
-
-
- HY-W012537
-
-
- HY-W012676
-
-
- HY-W012705
-
-
- HY-W012706
-
-
- HY-W012707
-
-
- HY-W012709
-
-
- HY-W012713
-
-
- HY-W012791
-
-
- HY-W012850
-
-
- HY-W012871
-
-
- HY-W012872
-
-
- HY-W012873
-
-
- HY-W012883
-
-
- HY-W012889
-
-
- HY-W012907
-
-
- HY-W012921
-
-
- HY-W012966
-
-
- HY-W012967
-
-
- HY-W013048
-
-
- HY-W013083
-
-
- HY-W013108
-
|
|
Amino Acid Derivatives
|
Others
|
|
(S)-2-((((9H-Fluoren-9-yl)methoxy)carbonyl)amino)-3-(4-((tert-butoxycarbonyl)amino)phenyl)propanoic acid is a phenylalanine derivative .
|
-
- HY-W013118
-
-
- HY-W013143
-
-
- HY-41257
-
-
- HY-W013144
-
-
- HY-W013145
-
-
- HY-W011280
-
-
- HY-W011279
-
-
- HY-W011278
-
-
- HY-W013163
-
-
- HY-W013182
-
-
- HY-W013185
-
-
- HY-W011201
-
-
- HY-W053702
-
-
- HY-W011200
-
-
- HY-W053701
-
|
|
Amino Acid Derivatives
|
Others
|
|
N2-(((9H-Fluoren-9-yl)methoxy)carbonyl)-N6-((5-(dimethylamino)naphthalen-1-yl)sulfonyl)-L-lysine is a lysine derivative .
|
-
- HY-W013201
-
|
|
Amino Acid Derivatives
|
Others
|
|
(S)-1-((S)-2-Amino-4-methylpentanoyl)pyrrolidine-2-carboxylic acid compound with 2,2,2-trifluoroacetic acid (1:1) is a proline derivative .
|
-
- HY-W053699
-
-
- HY-W011186
-
-
- HY-W011178
-
-
- HY-W006923
-
-
- HY-W011135
-
-
- HY-W011126
-
-
- HY-W011116
-
|
|
Amino Acid Derivatives
|
Others
|
|
(S)-2-((S)-2-((S)-2-Amino-4-methylpentanamido)-4-methylpentanamido)-4-methylpentanoic acid is a leucine derivative .
|
-
- HY-W011084
-
-
- HY-W013291
-
-
- HY-W013292
-
-
- HY-W013293
-
-
- HY-W013297
-
-
- HY-W013300
-
-
- HY-W013305
-
-
- HY-W013322
-
-
- HY-W013373
-
-
- HY-W013406
-
-
- HY-W013416
-
-
- HY-W013286
-
-
- HY-W053550
-
-
- HY-W013239
-
-
- HY-W013517
-
-
- HY-W013210
-
-
- HY-W013207
-
-
- HY-W013198
-
-
- HY-W013638
-
-
- HY-W011359
-
-
- HY-W013162
-
-
- HY-W013155
-
-
- HY-W013652
-
-
- HY-W051351
-
-
- HY-W013659
-
-
- HY-W011021
-
-
- HY-W050493
-
-
- HY-W013678
-
-
- HY-W050023
-
-
- HY-W011002
-
-
- HY-W013714
-
-
- HY-W010984
-
-
- HY-W010976
-
-
- HY-W010974
-
-
- HY-W008360
-
-
- HY-W013734
-
-
- HY-W048334
-
-
- HY-W008464
-
-
- HY-W008529
-
-
- HY-W013740
-
-
- HY-W013745
-
-
- HY-W045072
-
-
- HY-W043423
-
-
- HY-W042000
-
-
- HY-W041999
-
-
- HY-W041996
-
-
- HY-W041992
-
-
- HY-W041991
-
-
- HY-W041990
-
-
- HY-W041987
-
-
- HY-W041985
-
-
- HY-W041862
-
-
- HY-W040723
-
-
- HY-W142162
-
-
- HY-W040432
-
-
- HY-W142156
-
-
- HY-W040024
-
-
- HY-W039695
-
-
- HY-W013774
-
-
- HY-W037443
-
-
- HY-W036352
-
-
- HY-W036333
-
-
- HY-W142093
-
-
- HY-W036324
-
-
- HY-W036322
-
-
- HY-W036222
-
-
- HY-W013844
-
-
- HY-W013850
-
-
- HY-W035886
-
-
- HY-W013874
-
-
- HY-W013905
-
-
- HY-W013923
-
-
- HY-W013940
-
-
- HY-W007986
-
-
- HY-W013968
-
-
- HY-W007942
-
-
- HY-W013998
-
-
- HY-W007931
-
-
- HY-W014048
-
-
- HY-W014097
-
-
- HY-W014100
-
-
- HY-W142030
-
-
- HY-W030573
-
-
![((4'-Chloro-[1,1'-biphenyl]-4-yl)sulfonyl)phenylalanine](//file.medchemexpress.com/product_pic/hy-w030573.gif)
- HY-W007679
-
-
- HY-W007620
-
-
- HY-W014258
-
|
|
Amino Acid Derivatives
|
Others
|
|
(R)-2-((tert-Butoxycarbonyl)amino)pent-4-ynoic acid is a Glycine (HY-Y0966) derivative . (R)-2-((tert-Butoxycarbonyl)amino)pent-4-ynoic acid is a click chemistry reagent, it contains an Alkyne group and can undergo copper-catalyzed azide-alkyne cycloaddition (CuAAc) with molecules containing Azide groups.
|
-
- HY-W030321
-
-
- HY-W014259
-
|
|
Amino Acid Derivatives
|
Others
|
|
(S)-2-((tert-Butoxycarbonyl)amino)pent-4-ynoic acid is a Glycine (HY-Y0966) derivative . (S)-2-((tert-Butoxycarbonyl)amino)pent-4-ynoic acid is a click chemistry reagent, it contains an Alkyne group and can undergo copper-catalyzed azide-alkyne cycloaddition (CuAAc) with molecules containing Azide groups.
|
-
- HY-W029652
-
-
- HY-W014303
-
-
- HY-W028991
-
-
- HY-W007354
-
-
- HY-W028793
-
-
- HY-W027829
-
-
- HY-W006205
-
-
- HY-W027251
-
-
- HY-W026508
-
-
![1-[(3,5-Dimethylisoxazol-4-yl)sulfonyl]proline](//file.medchemexpress.com/product_pic/hy-w026508.gif)
- HY-W025811
-
-
- HY-W006093
-
-
- HY-W006063
-
-
- HY-W005913
-
-
- HY-W141986
-
-
- HY-W022796
-
-
![(S)-2-<em>Amino</em>-3-(benzo[b]thiophen-3-yl)propanoic acid](//file.medchemexpress.com/product_pic/hy-w022796.gif)
- HY-W005846
-
-
- HY-W022593
-
-
- HY-W005388
-
-
- HY-W141975
-
-
- HY-W005295
-
-
- HY-W005226
-
-
- HY-W022447
-
-
- HY-W022446
-
-
- HY-W022404
-
-
- HY-W004153
-
-
- HY-W004110
-
-
- HY-W004098
-
-
- HY-W022250
-
-
- HY-W141961
-
-
- HY-W003499
-
-
- HY-W003318
-
-
- HY-W022227
-
-
- HY-W022226
-
-
![N-[(9H-Fluoren-9-ylmethoxy)carbonyl]-O-(phenylmethyl)-D-serine](//file.medchemexpress.com/product_pic/hy-w022226.gif)
- HY-W022220
-
-
- HY-W141949
-
-
- HY-W141948
-
-
- HY-W002436
-
-
- HY-W002416
-
-
- HY-W002410
-
-
- HY-W141945
-
-
- HY-W002326
-
-
- HY-W141942
-
-
- HY-W141940
-
-
- HY-W002294
-
-
- HY-W002236
-
-
- HY-W001210
-
-
- HY-W001158
-
-
- HY-N7403
-
-
- HY-N0473A
-
-
- HY-I1111
-
-
- HY-W141918
-
-
- HY-I0931
-
-
- HY-W141912
-
-
- HY-W010946
-
-
- HY-W010943
-
-
- HY-W010931
-
-
- HY-W010930
-
|
|
Amino Acid Derivatives
|
Others
|
|
(R)-2-((((9H-Fluoren-9-yl)methoxy)carbonyl)amino)-3-(4-chlorophenyl)propanoic acid is a phenylalanine derivative .
|
-
- HY-W010927
-
-
- HY-I0423
-
-
- HY-W010926
-
-
- HY-I0377
-
-
- HY-W141895
-
-
- HY-W010893
-
-
- HY-W010880
-
-
- HY-W010871
-
-
- HY-W141885
-
-
- HY-W010862
-
-
- HY-W010850
-
-
- HY-W010839
-
-
- HY-W141879
-
-
- HY-W010838
-
-
- HY-W010836
-
-
- HY-W010830
-
-
- HY-79676
-
-
- HY-W141862
-
-
- HY-79648
-
-
- HY-79513
-
|
tert-Butyl [(R)-1-(methoxycarbonyl)-2-hydroxyethyl]carbamate
|
Amino Acid Derivatives
|
Others
|
|
(R)-Methyl 2-(tert-butoxycarbonylamino)-3-hydroxypropanoate is a serine derivative .
|
-
- HY-W010811
-
-
- HY-W010794
-
-
- HY-79295
-
|
N-BOC-3-Fluoro-D-phenylalanine; N-tert-Butoxycarbonyl-3-fluoro-D-phenylalanine
|
Amino Acid Derivatives
|
Others
|
|
N-BOC-3-Fluoro-D-phenylalanine is a phenylalanine derivative .
|
-
- HY-W010785
-
-
- HY-79294
-
-
- HY-79165
-
-
![(2S)-2-[(tert-Butoxycarbonyl)<em>amino</em>]-3-(3,4-difluorophenyl)propionic acid](//file.medchemexpress.com/product_pic/hy-79165.gif)
- HY-W010770
-
-
![Fmoc-Thr[PO(OBzl)OH]-OH](//file.medchemexpress.com/product_pic/hy-w010770.gif)
- HY-79131
-
-
- HY-W141842
-
-
- HY-W010745
-
-
- HY-W010734
-
-
- HY-W010732
-
-
- HY-79106
-
|
[1,1'-Biphenyl]-4-propanoic acid, α-amino-, (S)-; 4-Biphenylyl-L-alanine; 4-Phenyl-L-phenylalanine; Biphenylalanine
|
Amino Acid Derivatives
|
Others
|
|
L-Biphenylalanine is a phenylalanine derivative .
|
-
- HY-W141835
-
-
- HY-79046
-
|
Butanoic acid, 2-[[(1,1-dimethylethoxy)carbonyl]amino]-, (S)-; Butyric acid, 2-(carboxyamino)-, N-tert-butyl ester, L- (8CI); (2S)-2-(tert-Butoxycarbonylamino)butanoic acid; (2S)-2-[[(1,1-Dimethylethoxy)carbonyl]amino]butanoic acid
|
Amino Acid Derivatives
|
Others
|
|
Boc-L-2-aminobutanoic acid is an alanine derivative .
|
-
- HY-78912
-
-
- HY-W010724
-
-
- HY-78907
-
-
- HY-W019683
-
-
- HY-78906
-
-
- HY-W019676
-
-
- HY-W141831
-
-
- HY-W019265
-
-
- HY-W019263
-
-
- HY-78843
-
-
- HY-W019028
-
-
- HY-78733
-
-
- HY-W010698
-
-
- HY-W018850
-
-
- HY-W018849
-
-
- HY-W018717
-
-
- HY-W141821
-
-
- HY-W018650
-
-
- HY-78008
-
-
![N-[(1,1-Dimethylethoxy)carbonyl]-L-leucyl-L-leucine](//file.medchemexpress.com/product_pic/hy-78008.gif)
- HY-77894
-
-
- HY-W018620
-
-
- HY-W018528
-
-
- HY-77801
-
-
- HY-W141817
-
-
- HY-77757
-
-
- HY-77630
-
-
- HY-W018420
-
-
- HY-W141815
-
-
- HY-W018386
-
-
- HY-W010249
-
-
- HY-77519
-
-
- HY-77151
-
-
- HY-W141812
-
-
- HY-W018062
-
-
- HY-77026
-
-
- HY-W018050
-
-
- HY-W018045
-
-
- HY-W017617
-
-
- HY-W017551
-
-
- HY-W009911
-
-
- HY-W017501
-
-
- HY-76205
-
-
- HY-W017499
-
-
- HY-W009892
-
-
- HY-76204
-
-
- HY-75949
-
-
- HY-W009841
-
-
- HY-W009840
-
-
- HY-W017406
-
-
- HY-W141795
-
-
- HY-75379
-
-
- HY-W009762
-
-
- HY-W009734
-
-
- HY-W009693
-
-
- HY-66026
-
-
- HY-66025
-
-
- HY-W009682
-
-
- HY-W009648
-
-
- HY-W017150
-
-
- HY-65000
-
-
- HY-60264
-
-
- HY-W009630
-
-
- HY-W017069
-
|
|
Amino Acid Derivatives
|
Others
|
|
(S)-3-((((9H-Fluoren-9-yl)methoxy)carbonyl)amino)-4-(allyloxy)-4-oxobutanoic acid is an aspartic acid derivative .
|
-
- HY-60040
-
-
- HY-W016996
-
-
- HY-W016835
-
-
- HY-W016427
-
-
- HY-W016426
-
-
- HY-W141791
-
-
- HY-W016423
-
-
- HY-W016363
-
-
- HY-W016342
-
-
- HY-W016340
-
-
- HY-W016339
-
-
- HY-W016035
-
-
- HY-W016032
-
-
- HY-W141770
-
-
- HY-W016028
-
-
- HY-W140794
-
-
- HY-W015595
-
-
- HY-W129587
-
-
- HY-W015533
-
-
- HY-W015465
-
-
- HY-W015457
-
-
- HY-W015359
-
-
- HY-W015279
-
-
- HY-W015241
-
-
- HY-W128037
-
-
- HY-W128028
-
-
- HY-W127783
-
-
- HY-30230
-
-
- HY-30090
-
-
- HY-W014913
-
-
- HY-23174
-
-
- HY-W111382
-
-
- HY-W014663
-
-
- HY-W111211
-
-
- HY-W014553
-
-
- HY-22297
-
-
- HY-W110126
-
|
|
Amino Acid Derivatives
|
Others
|
|
(S)-3-((((9H-Fluoren-9-yl)methoxy)carbonyl)amino)-6-((tert-butoxycarbonyl)amino)hexanoic acid is a lysine derivative .
|
-
- HY-22062
-
-
- HY-W014418
-
-
- HY-22002
-
-
![N-[(9H-Fluoren-9-ylmethoxy)carbonyl]-5-methyl-L-norleucine](//file.medchemexpress.com/product_pic/hy-22002.gif)
- HY-W014405
-
-
- HY-W099595
-
-
- HY-W099255
-
-
- HY-20838A
-
-
- HY-W099254
-
-
- HY-20838
-
-
- HY-20834
-
-
- HY-20582
-
-
- HY-W098273
-
-
- HY-20561
-
-
- HY-W098059
-
-
- HY-20167
-
-
- HY-W092115
-
-
- HY-W092111
-
-
- HY-W009534
-
-
- HY-W009503
-
-
- HY-W090626
-
-
- HY-W009477
-
-
- HY-141447
-
|
α-N-Carbobenzoxy-L-lysine thiobenzyl ester monohydrochloride
|
Amino Acid Derivatives
|
Others
|
|
Z-LYS-SBZL (monohydrochloride) is a lysine derivative .
|
-
- HY-W009412
-
-
- HY-W077223
-
-
- HY-W009402
-
-
- HY-W009392
-
-
- HY-W072598
-
-
- HY-W009379
-
-
- HY-W072177
-
-
- HY-W009343
-
-
- HY-W009339
-
-
- HY-131173
-
-
- HY-W009329
-
-
- HY-122811
-
-
- HY-W009322
-
-
- HY-W009321
-
-
- HY-W009262
-
-
- HY-115393
-
-
- HY-W067478
-
-
- HY-W067360
-
-
- HY-W009244
-
-
- HY-113119
-
-
- HY-111592
-
-
- HY-W009204
-
-
- HY-W009151
-
-
- HY-W009119
-
-
- HY-W009110
-
-
- HY-W007722
-
-
- HY-W014238
-
-
- HY-W007798
-
-
- HY-W007875
-
-
- HY-W014076
-
-
- HY-W008022
-
-
- HY-W014000
-
-
- HY-W013962
-
-
- HY-W013906
-
-
- HY-W142083
-
-
- HY-W142086
-
-
- HY-W013870
-
-
- HY-W013864
-
-
- HY-W013810
-
-
- HY-W037549
-
-
- HY-W038703
-
-
- HY-W142115
-
-
- HY-W013793
-
-
- HY-W013780
-
-
- HY-W013779
-
-
- HY-W042007
-
-
- HY-W042009A
-
-
- HY-W042478
-
-
- HY-W008977
-
-
![N-[(9H-Fluoren-9-ylmethoxy)carbonyl]-O-(phenylmethyl)-L-serine](//file.medchemexpress.com/product_pic/hy-w008977.gif)
- HY-W013769
-
-
- HY-W008733
-
-
- HY-W048668
-
-
- HY-W048680
-
-
- HY-W008254
-
-
- HY-W013760
-
-
- HY-W013749
-
-
- HY-W013735
-
-
- HY-W050444
-
-
- HY-W011020
-
-
- HY-W050782
-
-
- HY-W013719
-
-
- HY-W051299
-
-
- HY-W013686
-
-
- HY-W013280
-
-
- HY-W013651
-
-
- HY-W008379
-
-
- HY-W013622
-
-
- HY-W013460
-
-
- HY-W013241
-
-
- HY-W014329
-
-
- HY-W014304
-
-
- HY-W008021
-
-
- HY-W013824
-
-
- HY-W041984
-
-
- HY-W008530
-
-
- HY-W048681
-
-
- HY-W022138
-
-
- HY-W010775
-
-
- HY-W010209
-
-
- HY-30216A
-
-
- HY-113064
-
|
|
Endogenous Metabolite
|
Cancer
|
|
Selenocystine is a broad-spectrum anti-cancer agent. Selenocystine induces DNA damage in HepG2 cells, particularly in the form of DNA double strand breaks (DSBs). Selenocystine exhibits great promise as a therapeutic or adjuvant agent targeting DNA repair for cancer treatment .
|
-
- HY-118535
-
-
- HY-119782
-
|
|
Fluorescent Dye
|
Others
|
|
L-Argininamide is a hydrophilic amino acid derivative and can be used as a compound for ligand binding DNA aptamers. L-Argininamide has the potential for fluorescent aptasensors development .
|
-
- HY-121520
-
-
- HY-121705
-
|
|
Endogenous Metabolite
|
Inflammation/Immunology
|
|
Propionyl-L-carnitine is a carnitine derivative and has a high affinity for muscular carnitine transferase. Propionyl-L-carnitine increases cellular carnitine content, thereby allowing free fatty acid transport into the mitochondria. Propionyl-L-carnitine alleviates the symptoms of PAD through a metabolic pathway, thereby improving exercise performance .
|
-
- HY-124081
-
|
|
Apoptosis
|
Metabolic Disease
|
|
N-Oleoyl-L-Serine is an endogenous amide of long-chain fatty acids with ethanolamine (N-acyl amides). N-Oleoyl-L-Serine is a lipid regulator of bone remodeling and stimulates osteoclast apoptosis. N-Oleoyl-L-Serine can be used for antiosteoporotic drug discovery development .
|
-
- HY-134124
-
|
|
Reactive Oxygen Species
|
Inflammation/Immunology
|
|
Glutathione ethyl ester is a cell-permeable GSH donor and provides an efficient supply of GSH to the oocyte. Glutathione ethyl ester shows positive effect on the in vitro production of embryos by enhancement of the antioxidative defense .
|
-
- HY-134445
-
-
- HY-139006
-
|
|
TRP Channel
|
Neurological Disease
|
|
N-oleoyl-glutamine is a PM20D1-regulated N-acyl amino acids (NAAs). N-oleoyl-glutamine is a transient receptor potential (TRP) antagonist .
|
-
- HY-120731
-
-
- HY-137416
-
-
- HY-137529
-
-
- HY-145512
-
-
- HY-B1581
-
-
- HY-N7831
-
-
- HY-W009472
-
-
- HY-W011155
-
-
- HY-W015897
-
-
- HY-W017200
-
-
- HY-W017255
-
|
L-R-(3-Thieyl)glycie; L-α-3-Thieylglycie
|
Amino Acid Derivatives
|
Others
|
|
(S)-3-Thienylglycine (L-R-(3-Thieyl)glycie; L-α-3-Thieylglycie) is aamino acids and their derivatives.
|
-
- HY-W018502
-
-
- HY-W020826
-
-
- HY-W074889
-
-
- HY-W097491
-
-
- HY-W101377
-
-
- HY-W105740
-
-
- HY-W105804
-
-
- HY-W107585
-
-
- HY-W131398
-
-
- HY-W142080
-
-
- HY-W330469
-
-
- HY-W345421
-
-
- HY-W745139
-
-
- HY-W004114
-
-
- HY-W019599
-
-
- HY-W291634
-
-
- HY-136934
-
|
[Boc-Glu(Obzl)]2-Lys-Ome
|
P-glycoprotein
|
Cancer
|
|
Reversin 205 ([Boc-Glu(Obzl)]2-Lys-Ome) is a P-glycoprotein (ABCB1) inhibitor. Reversin 205 is a peptide chemosensitizer .
|
-
- HY-P2089
-
|
|
MMP
|
Others
|
|
Dnp-PYAYWMR is a peptide substrate that selectively targets MMP3. Dnp-PYAYWMR is cleaved by MMP3 to produce Dnp-PYA (nonfluorescent) and YWMR (fluorophore detectable at 360 nm). After incubation of MMP3 with Dnp-PYAYWMR for 2 h, MMP3 fluorescence intensity was measured. Ex/Em=328/350 nm .
|
-
- HY-P10036
-
|
|
PKG
|
Others
|
|
G-Subtide is a G-substrate peptide localized in Purkinje cells of the cerebellum. G-Subtide has little activity distinct from background and is a preferentially phosphorylated peptide substrate of recombinant PfPKG2 protein .
|
-
- HY-P10038
-
|
Myr-FEEERA-OH
|
Integrin
|
Infection
|
|
mP6 (Myr-FEEERA-OH) is a myristoylated peptide. mP6 inhibits the interaction of Gα13 with integrin β3 without disrupting talin-dependent integrin function. mP6 can block the GTP usage of Rac1, Rap1, and Rab7, effectively inhibiting the infection of CHO-A24 cells .
|
-
- HY-P10058
-
|
|
Biochemical Assay Reagents
|
Cancer
|
|
cpm-1285m is a cell-permeable mutated peptide analogue of cpm-1285 (Bcl-2 inhibitory peptide). cpm-1285m contains a single substitution of alanine for Leu-151, and exhibits a decrease in Bcl-2 binding affinity with a reduction in IC50 of ∼15-fold. cpm-1285m can be used as a control of cpm-1285 .
|
-
- HY-P10056
-
|
Human ezrin peptide (324-337)
|
HIV
|
Infection
|
|
HEP-1 (Human ezrin peptide (324-337)) is an orally active peptide with anti-HIV activity. HEP-1 enhances antibody titers generated by hepatitis B vaccination. HEP-1 has the potential to be studied against viral infections .
|
-
- HY-P10062
-
|
|
Biochemical Assay Reagents
|
Metabolic Disease
|
|
Hylambatin, a tachykinin, increases both plasma glucose and plasma insulin, whereas the secretion of glucagon was not affected. Hylambatin can be used in diabetes research .
|
-
- HY-P10046
-
|
|
Vasopressin Receptor
|
Metabolic Disease
|
|
[Deamino-Pen1,Val4,D-Arg8]-vasopressin (AVP-A) is an arginine-vasopressin (AVP) antagonist. AVP-A can significantly lower plasma aldosterone concentration in rats. AVP-A can be used for the research of the growth and steroidogenic capacity of rat adrenal zona glomerulosa .
|
-
![[Deamino-Pen1,Val4,D-Arg8]-vasopressin](//file.medchemexpress.com/product_pic/hy-p10046.gif)
- HY-P10051
-
|
|
Ras
Raf
|
Cancer
|
|
Cyclorasin 9A5 is an 11-residue cell-permeable cyclic peptide that orthosterically inhibits the Ras-Raf protein interaction with an IC50 of 120 nM .
|
-
- HY-P10052
-
|
|
VEGFR
|
Cancer
|
|
CBO-P11 specifically binds to receptor of VEGFR-2 and is used as targeting ligand for tumor angiogenesis. CBO-P11 is modified with a nearinfrared cyanine dye bearing an alkyne function, allowing both “click” coupling on azido-modified nanoparticles and fluorescence labelling .
|
-
- HY-P10057
-
|
|
Apoptosis
|
Cancer
|
|
cpm-1285 induces apoptosis by functionally blocking intracellular Bcl-2 and related death antagonists. cpm-1285 shows strong binding potency to Bcl-2 with an IC50 value of 130 nM. cpm-1285 reduces tumor burden in mice .
|
-
- HY-P10060
-
-
- HY-P10065
-
-
- HY-P2682
-
|
|
MMP
|
Metabolic Disease
|
|
MMP-8/MMP-26 Fluorogenic substrate (DNP-Pro-Leu-Ala-Tyr-Trp-Ala-Arg) is a matrix metalloproteinase-8 (MMP-8) fluorogenic substrate. MMP-8/MMP-26 Fluorogenic substrate can be used for the research of atherosclerosis, pulmonary fibrosis, and sepsis .
|
-
- HY-W040705
-
|
N-Methylanthranilic acid
|
Drug Metabolite
|
Others
|
|
2-(Methylamino)benzoic acid is the main metabolite of methyl-N-methylanthranilates (MMA) (HY-76705) and is the compound in which the ester group is converted. MMA can be isolated from citrus fruits and has potential analgesic activity. 2-(Methylamino)benzoic acid was used to detect the metabolic levels of MMA in rat liver .
|
-
- HY-P10061
-
|
|
Cathepsin
|
Cancer
|
|
Cathepsin K inhibitor 4 is a potent carbohydrazide Cathepsin K inhibitor with IC50s of 13 nM, 269 nM, 296 nM for human, rat, mouse Cathepsin K, respectively .
|
-
- HY-P4201
-
|
|
Vasopressin Receptor
|
Cardiovascular Disease
|
|
JKC 301 is a selective Endothelin A receptor antagonist. JKC 301 attenuates the pressor effects of nicotine in rats. JKC 301 can be used to study cardiovascular disease caused by smoking .
|
-
- HY-126169
-
-
- HY-W010991
-
-
![N-[3-(2-Furyl)acryloyl]-Phe-Gly-Gly](//file.medchemexpress.com/product_pic/hy-w010991.gif)
- HY-W142117
-
|
|
Fluorescent Dye
|
Others
|
|
H-Asp(AMC)-OH, a amino acid derivative, is a fluorescent dye. H-Asp(AMC)-OH dose not inhibit glycine transport at a concentration of 0.25 mM .
|
-
| Cat. No. |
Product Name |
Type |
| Cat. No. |
Product Name |
Type |
-
- HY-W007618
-
|
|
Amino acids and Derivatives
|
|
Boc-Lys-OH is a lysine derivative of azocyclic and anthraquinone. Boc-Lys-OH is a polypeptide-based heterofunctional linking molecule, which can be used as a biomarker reagent .
|
-
- HY-W013781
-
|
|
Amino acids and Derivatives
|
|
Boc-Glu(OBzl)-OH (Compound 9) is a glutamic acid derivative commonly used in Boc SPPS. Glutamic acid residues increase the hydrophilicity of the polypeptide and play an important structural and receptor binding role .
|
-
- HY-W040074
-
| Cat. No. |
Product Name |
Target |
Research Area |
-
- HY-P4146
-
|
BI 456906
|
GLP Receptor
GCGR
|
Metabolic Disease
|
|
Survodutide (BI 456906) is a potent, selective glucagon receptor/GLP-1 receptor (GCGR/GLP-1R) dual agonist with EC50s of 0.52 nM and 0.33 nM in CHO-K1 cells, respectively. Survodutide, a 29-amino-acid peptide, is a potent acylated peptide containing a C18 fatty acid. Survodutide has robust anti-obesity efficacy achieved by increasing energy expenditure and decreasing food intake .
|
-
- HY-P4146A
-
|
BI 456906 TFA
|
GLP Receptor
GCGR
|
Metabolic Disease
|
|
Survodutide (BI 456906) TFA is a potent, selective glucagon receptor/GLP-1 receptor (GCGR/GLP-1R) dual agonist with EC50s of 0.52 nM and 0.33 nM in CHO-K1 cells, respectively. Survodutide TFA, a 29-amino-acid peptide, is a potent acylated peptide containing a C18 fatty acid. Survodutide TFA has robust anti-obesity efficacy achieved by increasing energy expenditure and decreasing food intake .
|
-
- HY-P3581
-
|
|
Potassium Channel
|
Neurological Disease
|
|
PE 22-28 is a TREK-1 inhibitor with IC50 value of 0.12 nM. PE 22-28 also is a 7 amino-acid peptide that is used as a core sequence for preparing analogs by chemical modifications and also by substitution of amino-acids. PE 22-28 can be used for the research of depression .
|
-
- HY-P3611
-
|
|
Peptides
|
Metabolic Disease
|
|
Valosin (porcine) is a biologically active peptide with 25-amino-acid. Valosin (porcine) can be isolated recently from pig intestine. Valosin (porcine) can be used for the research of digestive system .
|
-
- HY-P1511
-
-
- HY-P0173
-
|
|
Peptides
|
Cancer
|
|
Chlorotoxin(linear) is a linear 36 amino-acid peptide which can be used in Chlorotoxin related research.
|
-
- HY-P0173A
-
|
|
Chloride Channel
|
Cancer
|
|
Chlorotoxin is a 36 amino-acid peptide from the venom of the Israeli scorpion Leiurus quinquestriatus with anticancer activity. Chlorotoxin is a chloride channel blocker.
|
-
- HY-P2207
-
|
|
Biochemical Assay Reagents
|
Others
|
|
Sinapultide is a 21-amino-acid peptide that mimics the action of human surfactant protein-B (SP-B). Sinapultide can be used for synthetic phospholipids surfactants improvement .
|
-
- HY-P2534
-
|
|
Peptides
|
Metabolic Disease
|
|
C-Peptide 2, rat, 31-amino-acid peptide, is a component of proinsulin. C-Peptide 2, rat can inhibit glucose-induced insulin secretion .
|
-
- HY-P2526
-
|
|
Peptides
|
Cancer
|
|
LyP-1 is a cyclic 9‐amino‐acids tumor homing peptide and selectively bind to p32 receptors overexpressed in various tumor-associated cells .
|
-
- HY-P3811
-
|
|
CaMK
|
Neurological Disease
|
|
Autocamtide-3, a 13-amino-acid peptide containing Thr287, is a selective CaMKII (Ca 2+/calmodulin-dependent kinase II) (CaMK) substrate .
|
-
- HY-P3811A
-
|
|
CaMK
|
Neurological Disease
|
|
Autocamtide-3 acetate, a 13-amino-acid peptide containing Thr287, is a selective CaMKII (Ca 2+/calmodulin-dependent kinase II) (CaMK) substrate .
|
-
- HY-P0285
-
|
|
RABV
|
Infection
|
|
Rabies Virus Glycoprotein is a 29-amino-acid cell penetrating peptide derived from a rabies virus glycoprotein that can cross the blood-brain barrier (BBB) and enter brain cells.
|
-
- HY-P1856
-
|
|
Peptides
|
Metabolic Disease
|
|
Proinsulin C-peptide (human) is a 31-amino-acid peptide that links the A and B chains of proinsulin, ensuring its correct folding, which is biologically active and modulates cellular function .
|
-
- HY-P2526A
-
|
|
Peptides
|
Cancer
|
|
LyP-1 TFA is a cyclic 9‐amino‐acids tumor homing peptide and selectively bind to p32 receptors overexpressed in various tumor-associated cells .
|
-
- HY-P2207A
-
|
|
Biochemical Assay Reagents
|
Others
|
|
Sinapultide TFA is a 21-amino-acid peptide that mimics the action of human surfactant protein-B (SP-B). Sinapultide TFA can be used for synthetic phospholipids surfactants improvement .
|
-
- HY-P0285A
-
|
|
RABV
|
Infection
|
|
Rabies Virus Glycoprotein (TFA) is a 29-amino-acid cell penetrating peptide derived from a rabies virus glycoprotein that can cross the blood-brain barrier (BBB) and enter brain cells .
|
-
- HY-P1714
-
|
FE 203799
|
GLP Receptor
|
Metabolic Disease
|
|
Apraglutide (FE 203799), a synthetic 33-amino-acid peptide and a long-acting GLP-2 analogue, enhances adaptation and linear intestinal growth in a neonatal piglet model of short bowel syndrome with total resection of the ileum .
|
-
- HY-P10126
-
|
|
Peptides
|
Others
|
|
Osteocalcin, bovine is a vitamin K-dependent bone specific protein. Osteocalcin, bovine is also known as bone gamma-carboxyglutamic acid-containing protein (BGLAP). Osteocalcin, bovine is a small (49-amino-acid) noncollagenous protein hormone .
|
-
- HY-P1714A
-
|
FE 203799 TFA
|
GLP Receptor
|
Metabolic Disease
|
|
Apraglutide TFA (FE 203799 TFA), a synthetic 33-amino-acid peptide and a long-acting GLP-2 analogue, enhances adaptation and linear intestinal growth in a neonatal piglet model of short bowel syndrome with total resection of the ileum .
|
-
- HY-P1298
-
|
|
CRFR
|
Cardiovascular Disease
Neurological Disease
Endocrinology
|
|
Sauvagine, a 40-amino-acid neuropeptide from the skin of the frog, is a mammalian CRF agonist. Sauvagine is effective at releasing ACTH from rat pituitary cells. Sauvagine possesses a number of pharmacological actions on diuresis, the cardiovascular system and endocrine glands .
|
-
- HY-P1293
-
|
|
iGluR
|
Neurological Disease
|
|
Conantokin G, a 17-amino-acid peptide, is a potent, selective and competitive antagonist of N-methyl-D-aspartate (NMDA) receptors. Conantokin G inhibits NMDA-evoked currents in murine cortical neurons with an IC50 of 480 nM. Conantokin G has neuroprotective properties .
|
-
- HY-P1298A
-
|
|
CRFR
|
Cardiovascular Disease
Neurological Disease
Endocrinology
|
|
Sauvagine TFA, a 40-amino-acid neuropeptide from the skin of the frog, is a mammalian CRF agonist. Sauvagine TFA is effective at releasing ACTH from rat pituitary cells. Sauvagine TFA possesses a number of pharmacological actions on diuresis, the cardiovascular system and endocrine glands .
|
-
- HY-P1293A
-
|
|
iGluR
|
Neurological Disease
|
|
Conantokin G TFA, a 17-amino-acid peptide, is a potent, selective and competitive antagonist of N-methyl-D-aspartate (NMDA) receptors. Conantokin G TFA inhibits NMDA-evoked currents in murine cortical neurons with an IC50 of 480 nM. Conantokin G TFA has neuroprotective properties .
|
-
- HY-P1525
-
|
MCH (salmon)
|
MCHR1 (GPR24)
|
Cardiovascular Disease
Neurological Disease
Metabolic Disease
Endocrinology
|
|
Melanin Concentrating Hormone, salmon is a 19-amino-acid neuropeptide initially identified in the pituitary gland of teleost fish, which regulates food intake, energy balance, sleep state, and the cardiovascular system. Melanin-concentrating hormone is a ligand for an orphan G protein-coupled receptor (SLC-1/GPR24) and MCHR2.
|
-
- HY-105037
-
|
IPP-201101
|
Autophagy
|
Inflammation/Immunology
|
|
Forigerimod (IPP-201101) is a CD4 T-cell modulator. Forigerimod is a 21-amino-acid fragment of U1 small nuclear ribonucleoprotein 70 kDa that is phosphorylated at Ser140. Forigerimod can potently inhibit autophagy. Forigerimod can be used for the research of autoimmune disorders, such as systemic lupus erythematosus (SLE) .
|
-
- HY-P1674A
-
|
POL7080 TFA
|
Bacterial
Antibiotic
|
Infection
|
|
Murepavadin (POL7080) (TFA), a 14-amino-acid cyclic peptide, is a highly potent, specific antibiotic. Murepavadin exhibits a potent antimicrobial activity for P. aeruginosa with MIC50 and MIC90 values both of 0.12 mg/L. Murepavadin also can target the lipopolysaccharide transport portin D. Murepavadin can be used for the research of bacterial resistance .
|
-
- HY-P2230
-
|
A6 Peptide
|
PAI-1
|
Cancer
|
|
Angstrom6 (A6 Peptide) is an 8 amino-acid peptide derived from single-chain urokinase plasminogen activator (scuPA) and interferes with the uPA/uPAR cascade and abrogates downstream effects. Angstrom6 binds to CD44 resulting in the inhibition of migration, invasion, and metastasis of tumor cells, and the modulation of CD44-mediated cell signaling .
|
-
- HY-P1674
-
|
POL7080
|
Bacterial
Antibiotic
|
Infection
|
|
Murepavadin (POL7080), a 14-amino-acid cyclic peptide, is a highly potent, specific antibiotic. Murepavadin exhibits a potent antimicrobial activity for P. aeruginosa with both MIC50 and MIC90 values of 0.12 mg/L. Murepavadin also can target the lipopolysaccharide transport portin D. Murepavadin can be used for the research of bacterial resistance .
|
-
- HY-P1525A
-
|
MCH (salmon) (TFA)
|
MCHR1 (GPR24)
|
Cardiovascular Disease
Neurological Disease
Metabolic Disease
Endocrinology
|
|
Melanin Concentrating Hormone, salmon TFA (MCH (salmon) TFA) is a 19-amino-acid neuropeptide initially identified in the pituitary gland of teleost fish, which regulates food intake, energy balance, sleep state, and the cardiovascular system. Melanin-concentrating hormone is a ligand for an orphan G protein-coupled receptor (SLC-1/GPR24) and MCHR2.
|
-
- HY-105037A
-
|
IPP-201101 TFA
|
Autophagy
|
Inflammation/Immunology
|
|
Forigerimod TFA (IPP-201101 TFA) is a CD4 T-cell modulator. Forigerimod TFA is a 21-amino-acid fragment of U1 small nuclear ribonucleoprotein 70 kDa that is phosphorylated at Ser140. Forigerimod TFA can potently inhibit autophagy. Forigerimod can be used for the research of autoimmune disorders, such as systemic lupus erythematosus (SLE) .
|
-
- HY-P3431
-
|
|
iGluR
|
Neurological Disease
|
|
VSGLNPSLWSIFGLQFILLWLVSGSRHYLW is a 30-amino-acid peptide mimicking the C-terminal domain of α2δ-1, termed as α2δ-1Tat peptide. VSGLNPSLWSIFGLQFILLWLVSGSRHYLW can effectively interrupt the α2δ-1 - NMDAR interaction in vitro and in vivo. VSGLNPSLWSIFGLQFILLWLVSGSRHYLW can be used for researching neuropathic pain .
|
-
- HY-P3906
-
|
|
Fungal
Apoptosis
Phospholipase
Reactive Oxygen Species
|
Infection
|
|
Melittin free acid is a basic 26-amino-acid polypeptide, the major active ingredient of honeybee venom. Melittin free acid is an activator of phospholipase A2 (PLA2). Melittin free acid has broad-spectrum antifungal activity with MIC values of 0.4-60 μM. Melittin free acid hinders fungal growth by inducing cell apoptosis, repressing (1,3)-β-D-glucan synthase and participating in other pathways .
|
-
- HY-P4837
-
|
|
Peptides
|
Others
|
|
Ac-Lys-D-Ala-D-lactic acid is a polypeptide that can be found by peptide screening. Peptide screening is a research tool that pools active peptides primarily by immunoassay. Peptide screening can be used for protein interaction, functional analysis, epitope screening, especially in the field of agent research and development .
|
-
- HY-P3431A
-
|
|
iGluR
|
Neurological Disease
|
|
VSGLNPSLWSIFGLQFILLWLVSGSRHYLW (TFA) is a 30-amino-acid peptide mimicking the C-terminal domain of α2δ-1, termed as α2δ-1Tat peptide. VSGLNPSLWSIFGLQFILLWLVSGSRHYLW can effectively interrupt the α2δ-1 - NMDAR interaction in vitro and in vivo. VSGLNPSLWSIFGLQFILLWLVSGSRHYLW can be used for researching neuropathic pain .
|
-
- HY-P10200
-
|
|
Bacterial
|
Infection
|
|
CP7-FP13-2 is a peptide with antivirulence factor and antibacterial activity. CP7-FP13-2 inhibits the formation of Staphylococcus aureus biofilm and has good antibacterial efficacy in mice .
|
-
- HY-P3462
-
|
|
CGRP Receptor
|
Metabolic Disease
|
|
Cagrilintide is an investigational novel long-acting acylated amylin analogue, acts as nonselective amylin receptors (AMYR) and calcitonin G protein-coupled receptor (CTR) agonist. Cagrilintide induces significant weight loss and reduces food intake. Cagrilintide has the potential for the research of obesity .
|
-
- HY-P3462A
-
|
|
CGRP Receptor
|
Metabolic Disease
|
|
Cagrilintide acetate is a non-selective AMYR/CTR agonist and long-acting acylated amylase analogue. Cagrilintide acetate causes a reduction in food intake and significant weight loss in a dose-dependent manner. Cagrilintide acetate can be used in obesity studies .
|
-
- HY-P5161A
-
|
|
GCGR
|
Metabolic Disease
|
|
FC382K10W15 TFA is a glucagon analogue and GLP-1R/GCGR agonist. FC382K10W15 TFA can be used in type 2 diabetes research .
|
-
- HY-P5161
-
-
- HY-P0041A
-
-
- HY-P4757
-
|
|
Peptides
|
Others
|
|
N1-Glutathionyl-spermidine disulfide is a substrate of trypanothione reductase .
|
-
- HY-P3143
-
|
|
PD-1/PD-L1
|
Cancer
|
|
BMSpep-57 is a potent and competitive macrocyclic peptide inhibitor of PD-1/PD-L1 interaction with an IC50 of 7.68 nM. BMSpep-57 binds to PD-L1 with Kds of 19 nM and 19.88 nM in MST and SPR assays, respectively. BMSpep-57 facilitates T cell function by in creasing IL-2 production in PBMCs .
|
-
- HY-P3143A
-
|
|
PD-1/PD-L1
|
Cancer
|
|
BMSpep-57 hydrochloride is a potent and competitive macrocyclic peptide inhibitor of PD-1/PD-L1 interaction with an IC50 of 7.68 nM. BMSpep-57 hydrochloride binds to PD-L1 with Kds of 19 nM and 19.88 nM in MST and SPR assays, respectively. BMSpep-57 hydrochloride facilitates T cell function by in creasing IL-2 production in PBMCs .
|
-
- HY-P1162
-
-
- HY-P2434
-
|
|
Somatostatin Receptor
|
Neurological Disease
Metabolic Disease
Cancer
|
|
AP102 is a dual SSTR2/SSTR5-specific somatostatin analog (SSA). AP102 is a disulfide-bridged octapeptide SSA containing synthetic iodinated amino acids. AP102 binds with subnanomolar affinity to SSTR2 and SSTR5 (IC50: 0.63 and 0.65 nM, respectively). AP102 does not bind to SSTR1 or SSTR3. AP102 can be used for acromegaly and neuroendocrine tumors research .
|
-
- HY-P10031
-
|
|
GLP Receptor
GCGR
|
Metabolic Disease
|
|
SAR441255 is a potent unimolecular peptide GLP-1/GIP/GCG receptor triagonist. SAR441255 displays high potency with balanced activation of all three target receptors.?SAR441255 shows positive acute glucoregulatory effectss in diabetic obese monkeys .
|
-
- HY-P10031A
-
|
|
GLP Receptor
|
Metabolic Disease
|
|
SAR441255 TFA is a potent unimolecular peptide GLP-1/GIP/GCG receptor triagonist. SAR441255 TFA displays high potency with balanced activation of all three target receptors.?SAR441255 TFA shows positive acute glucoregulatory effectss in diabetic obese monkeys .
|
-
- HY-P4895
-
|
|
Oxytocin Receptor
|
Neurological Disease
|
|
(d(CH2)51,Tyr(Me)2,Orn8)-Oxytocin (OVT) is an oxytocin receptor antagonist. (d(CH2)51,Tyr(Me)2,Orn8)-Oxytocin can be used for the research of neurological disease .
|
-
- HY-P5362
-
|
|
Somatostatin Receptor
|
Cancer
|
|
NODAGA-LM3 can be labeled by 68Ga for PET imaging. 68Ga-NODAGA-LM3 is a SSTR2 antagonist, and can be used for imaging of SSTR positive paragangliomas .
|
- HY-P5362A
-
|
|
Somatostatin Receptor
|
Cancer
|
|
NODAGA-LM3 TFA can be labeled by 68Ga for PET imaging. 68Ga-NODAGA-LM3 TFA is a SSTR2 antagonist, and can be used for imaging of SSTR positive paragangliomas .
|
- HY-105168
-
|
|
Endothelin Receptor
|
Cardiovascular Disease
|
|
TAK 044 is an antagonist of Endothelin Receptor. TAK 044 strongly inhibits ET-induced deterioration in various animal models. TAK 044 can be used in study ET-related diseases such as acute myocardial infarction,acute renal failure, acute hepatic malfunction, and subarachnoid hemorrhage .
|
- HY-14743
-
|
SCV 07; Gamma-D-glutamyl-L-tryptophan
|
Bacterial
STAT
|
Infection
Inflammation/Immunology
Cancer
|
|
Golotimod (SCV-07), an immunomodulating peptide with antimicrobial activity, significantly increases the efficacy of antituberculosis therapy, stimulates thymic and splenic cell proliferation, and improves macrophage function. Golotimod (SCV-07) inhibits STAT3 signaling and modulates the duration and severity of oral mucositis in animal models that received radiation or a combination of radiation and Cisplatin. Golotimod (SCV-07) is also a potential therapeutic for recurrent genital herpes simplex virus type 2 (HSV-2) .
|
- HY-W013097
-
|
|
Amino Acid Derivatives
|
Others
|
|
Boc-Arg(di-Z)-OH can be used for the synthesis of amino acid. Boc-Arg(di-Z)-OH can be used for the research of inhibitors for processing proteinases. Boc-Arg(di-Z)-OH is coupled via the mixed anhydride (MA) with HGlu(OBzl)-Lys(Z)-Arg(Z,Z)-CH2Cl .
|
- HY-W011075
-
- HY-W021482
-
- HY-W048199
-
- HY-W022255
-
|
D-Fmoc-glutamic acid
|
Amino Acid Derivatives
|
Others
|
|
Fmoc-D-Glu-OH (D-Fmoc-glutamic acid) is a derivative of glutamate, can be used to prepare supramolecular hydrogels .
|
- HY-W008326
-
- HY-W012000
-
|
Boc-N-Me-Ile-OH
|
Amino Acid Derivatives
|
Others
|
|
Boc-N-methyl-L-isoleucine (Boc-N-Me-Ile-OH) is a peptide products and can be used as a precursor in organic synthesis and pharmaceuticals .
|
- HY-W042005
-
|
|
Amino Acid Derivatives
|
Others
|
|
H-D-Phe(3,4-DiCl)-OH is D-3,4-Dichlorophenylalanine, a amino acid derivative. H-D-Phe(3,4-DiCl)-OH shows protein synthesis activity .
|
- HY-78824
-
|
|
Peptides
|
Others
|
|
Glycine, N-[(1,1-dimethylethoxy)carbonyl]thio-L-phenylalanyl-, methyl ester (compound 3b) is a polypeptide compound containing sulfamide, can be used to synthesis peptide-agent coupling compounds .
|
- HY-W048700
-
- HY-W041076
-
- HY-W050025
-
- HY-W141781
-
|
Cystaphos sodium
|
Peptides
|
Metabolic Disease
|
|
Cysteamine S-phosphate (Cystaphos) sodium can be hydroIyzed to Cysteamine by human alkaline phosphatases. Cysteamine is an orally active agent for the research of nephropathic cystinosis and an antioxidant .
|
- HY-Y1636
-
|
|
Amino Acid Derivatives
|
Others
|
|
Fmoc-Arg(Pbf)-OH is an arginine derivative containing amine protecting group Fmoc. Fmoc-Arg(Pbf)-OH is a building block for the introduction of Arg into SPPS (Solid-Phase Peptide Synthesis) .
|
- HY-W048209
-
|
|
Amino Acid Derivatives
|
Others
|
|
Fmoc-Lys(Palmitoyl)-OH is a Fmoc-amino acid with long alkyl chains. Fmoc-Lys(Palmitoyl)-OH can be used for peptide synthesis .
|
- HY-W009203
-
|
|
Peptides
|
Others
|
|
L-Cystine dihydrochloride can be used as a cell culture component and is a sulfur-containing precursor of glutathione (GSH) synthesis. L-Cystine dihydrochloride homeostasis is also important for GSH functions .
|
- HY-W039102
-
|
|
Amino Acid Derivatives
|
Cancer
|
|
N-Fmoc-N,O-dimethyl-L-serine is a serine derivative that can be used for coibamide A synthesis. Coibamide A is a marine natural product with potent antiproliferative activity against human cancer cells .
|
- HY-W061614
-
|
|
Amino Acid Derivatives
|
Others
|
|
(4R)-1-Boc-4-fluoro-D-proline is an amino acid derivative that can be used for preparation of peptidomimetics, dihydropyridopyrimidines and pyridopyrimidines .
|
- HY-W074914
-
- HY-W013726
-
- HY-W019205
-
- HY-35028
-
|
|
Amino Acid Derivatives
|
Others
|
|
Boc-Glu-Ofm is a peptide. Boc-Glu-Ofm has been used for the synthesis of ester insulin and cyclic peptide mixtures .
|
- HY-75332
-
|
D-Cbz phenylglycine
|
Amino Acid Derivatives
|
Others
|
|
Z-D-Phg-OH (D-Cbz phenylglycine) is a N-blocked amino acids with Kd values of 390 μM and 323 μM for tBuCQN and tBuCQD, respectively .
|
- HY-W048332
-
- HY-W039112
-
- HY-79709
-
|
|
Amino Acid Derivatives
|
Others
|
|
N-(Methoxycarbonyl)-D-valine methyl ester is an amino acid derivative that can be used for compound synthesis .
|
- HY-77635
-
- HY-W007223
-
|
D-5-HTP; 5-Hydroxy-D-tryptophan
|
Peptides
5-HT Receptor
|
Neurological Disease
|
|
D-5-Hydroxytryptophan (D-5-HTP) is the D-isomer of 5-HTP and can be isolated from DL-5-hydroxytryptophan by continuous separation. Compared with intraperitoneal administration of L-5-Hydroxytryptophan, which can induce dose-dependent backward walking behavior in mice, D-5-Hydroxytryptophan has no significant effect on mouse behavior and is a negative control. D-5-Hydroxytryptophan is also a 5-HT ligand, capable of binding to the 5-HT site with affinity in the micromolar range .
|
- HY-20897A
-
- HY-60265
-
- HY-W013152
-
- HY-W016424
-
- HY-W048825
-
|
|
Amino Acid Derivatives
|
Others
|
|
Fmoc-Ala-Ala-OH (3) is a self-assemble fluorenylmethoxycarbonyl-dipeptide, which is a smaller amphiphilic building blocks consists dipeptides linked to fluore nylmethoxycarbonyl (Fmoc). Fmoc-Ala-Ala-OH can be used as scaffold materials in 3D cell culture .
|
- HY-W048830
-
- HY-W141788
-
|
|
Peptides
|
Infection
|
|
N-Butyryl-DL-homocysteine thiolactone is an N-acyl homoserine lactone (AHL) analogue. AHLs are potent inhibitors of biofilm formation and virulence factors, and has been used for degrading microbial communities, reducing bacterial pathogenicity .
|
- HY-W141810
-
|
H-Phe(4-NH2)-OH hydrochloride
|
Endogenous Metabolite
|
Others
|
|
4-Amino-L-phenylalanine (H-Phe(4-NH2)-OH) hydrochloride is an endogenous metabolite.
|
- HY-113084
-
|
|
iGluR
Endogenous Metabolite
|
Neurological Disease
|
|
L-Cysteine S-sulfate is a potent N-methyl-d-aspartate (NMDA) glutamatergic receptor agonist. L-Cysteine S-sulfate is the substrate for cystine lyase, and can be used in mass spectrometry operations .
|
- HY-119543
-
|
|
Amino Acid Derivatives
|
Others
|
|
O-Succinyl-L-homoserine is a homoserine derivative. O-Succinyl-L-homoserine is an intermediate in the biosynthesis of methionine in Escherichia coli and Salmonella typhimurium .
|
- HY-41121
-
|
Boc-Ala-OH
|
Amino Acid Derivatives
|
Others
|
|
Boc-L-Ala-OH (Boc-Ala-OH) shows excellent affinity with ATP. Boc-L-Ala-OH contains an amino acid moiety, and an acylamide bond like that of the peptide and protein .
|
- HY-W002299
-
|
Boc-D-Leu-OH hydrate
|
Amino Acid Derivatives
|
Neurological Disease
|
|
Boc-D-Leucine monohydrate (Boc-D-Leu-OH hydrate) is an N-Boc-protected form of D-Leucine (L330150). D-Leucine is an unnatural isomer of L-Leucine (L330110) that acts as an auto-inhibitor of lactic streptococci. D-Leucine shows potent anti-seizure effect .
|
- HY-W005308
-
|
|
Amino Acid Derivatives
|
Cancer
|
|
N-BOC-DL-serine methyl ester is a Serine derivative. N-BOC-DL-serine methyl ester is used for the synthesis of α,β-dehydro-α-amino acid. N-BOC-DL-serine methyl ester is also used for the synthesis of anti-cancer agent, such as quinazolinone derivative that inhibits PI3K activity, and tricyclic pyrolopyranopyridines that inhibits protein kinase activity .
|
- HY-W006064
-
|
|
Peptides
|
Others
|
|
(S)-2-Aminopent-4-ynoic acid is a synthetic amino acid. (S)-2-Aminopent-4-ynoic acid can be used in synthesis of folate-conjugates and corresponding metal-chelate complexes . (S)-2-Aminopent-4-ynoic acid is a click chemistry reagent, it contains an Alkyne group and can undergo copper-catalyzed azide-alkyne cycloaddition (CuAAc) with molecules containing Azide groups.
|
- HY-W009215
-
|
L-Met-L-Ala-L-Ser
|
Peptides
|
Others
|
|
H-Met-Ala-Ser-OH (L-Met-L-Ala-L-Ser) is a tripeptide. H-Met-Ala-Ser-OH can act as a formyl receptor .
|
- HY-W010712
-
|
|
Amino Acid Derivatives
|
Others
|
|
Fmoc-His(Trt)-OH has trityl (Trt) group to protect the side-chain of His. Fmoc-His(Trt)-OH has Fmoc group to protect -αNH2. Fmoc-His(Trt)-OH can be used for solid phase synthesis of peptides, providing protection against racemization and by-product formation .
|
- HY-W010955
-
|
NSC 334018
|
Biochemical Assay Reagents
|
Others
|
|
Z-Phe-Leu-OH (NSC 334018) is a substrate for carboxypeptidase Y (CPY). Z-Phe-Leu-OH is incubated with recombinant CPY to determine peptidase activity .
|
- HY-W012159
-
|
H-MET-SER-OH
|
Angiotensin-converting Enzyme (ACE)
|
Cardiovascular Disease
|
|
Methionylserine (H-MET-SER-OH) is a methionine- and serine-containing dipeptide. Methionylserine binds to and translocation via intestinal di/tri-peptide transporter 1 (hPEPT1) with a Km value of 0.2 mM. Methionylserine inhibits ACE enzyme activity. Methionylserine can be used in the research of hypension .
|
- HY-W013123
-
|
|
Amino Acid Derivatives
|
Others
|
|
Fmoc-D-Phe(4-CF3)-OH is Phenylalanine derivative. Fmoc-D-Phe(4-CF3)-OH can be used for the research of peptide inhibitors of protein-protein interactions .
|
- HY-W022657
-
|
|
Amino Acid Derivatives
|
Others
|
|
H-Met-OiPr hydrochloride is an Methionine derivative. H-Met-OiPr hydrochloride participates in the synthesis preparation of inhibitors of farnesyl-protein transferase (FTase), and can be used in cancer research .
|
- HY-W036160
-
|
|
Amino Acid Derivatives
|
Others
|
|
N-Fmoc-O-ethyl-L-homoserine is an homoserine derivative, can be used in cyclic peptide compounds synthesis, as a reducing reagent .
|
- HY-W039756
-
|
NSC 334362
|
Amino Acid Derivatives
|
Others
|
|
Boc-Ala-Ala-OH (NSC 334362) is an Alanine derivative. Boc-Ala-Ala-OH is used in the preparation of anti-bacterial agent .
|
- HY-W141881
-
|
|
Biochemical Assay Reagents
|
Others
|
|
N-lauroylsarcosine is an anionic surfactant, and can be used as a permeation enhancer. The mixture of N-lauroylsarcosine in 25-50% ethanol acts synergistically to increase skin permeability, which may be useful for transdermal drug delivery research .
|
- HY-W015424
-
- HY-21983
-
|
|
Peptides
|
Others
|
|
O-Acetyl-N-[(1,1-dimethylethoxy)carbonyl]-L-threonine is a compound containing both an amino group and a carboxyl group.
|
- HY-W041983
-
- HY-76317
-
|
N-Cbz-DL-proline; DL-Cbz-Proline
|
Amino Acid Derivatives
|
Others
|
|
Z-DL-Pro-OH (N-Cbz-DL-proline) is a proline derivative, can be used for the synthesis of agents or other compounds .
|
- HY-W010873
-
- HY-W008922
-
- HY-W016330
-
- HY-W015450
-
|
|
Endogenous Metabolite
|
Others
|
|
D-Ala-D-Ala constitutes the terminus of the peptide part of the peptidoglycan monomer unit and is involved in the transpeptidation reaction as the substrate. D-Ala-D-Ala is catalyzed by D-Alanine-D-Alanine ligase. D-Ala-D-Ala is a bacterial endogenous metabolite .
|
- HY-W142092
-
|
|
Bacterial
|
Others
|
|
N-Acetyl-DL-serine is a hydrophobic amino acid that is synthesized in the body and can be found as a free form or as a salt with malonate, phosphate, or acetate. N-Acetyl-DL-serine has antimicrobial activity against Bacillus cereus and Staphylococcus aureus. N-Acetyl-DL-serine has also been used for the immobilization of DNA fragments on solid surfaces and can be used for protein synthesis and optical detection of DNA strands .
|
- HY-W065053
-
|
|
Amino Acid Derivatives
|
Others
|
|
trans-N-Methyl-4-methoxyproline is a natural product that can be isolated from the stems of Petiveria alliacea and is also a Proline derivative .
|
- HY-42709
-
- HY-W048829
-
|
|
Amino Acid Derivatives
|
Others
|
|
Boc-Phe-Gly-OH is a Boc-protected phenylalanyl glycine derivative, can be used for the synthesis of agents or other compounds .
|
- HY-W052227
-
- HY-W048205
-
|
|
Amino Acid Derivatives
|
Others
|
|
N6-Diazo-L-Fmoc-lysine is an active compand and can be used in a variety of chemical studies. N6-Diazo-L-Fmoc-lysine is a click chemistry reagent, it contains an Azide group and can undergo copper-catalyzed azide-alkyne cycloaddition reaction (CuAAc) with molecules containing Alkyne groups. Strain-promoted alkyne-azide cycloaddition (SPAAC) can also occur with molecules containing DBCO or BCN groups.
|
- HY-W040734
-
|
|
Peptides
|
Others
|
|
(tert-Butoxycarbonyl)glycylglycylglycine is an active compand and can be used in a variety of chemical studies.
|
- HY-W037451
-
|
|
Amino Acid Derivatives
|
Others
|
|
Methyl L-leucinate, methyl ester of L-leucine, is an alpha-amino acid ester. Methyl L-leucinate is a derivative of methyl ester and L-leucine, a class of compounds containing both amino and carboxyl groups in the molecule .
|
- HY-W011458
-
|
|
Amino Acid Derivatives
|
Others
|
|
3,5-Dinitro-L-tyrosine sodium is a tyrosine derivative. 3,5-Dinitro-L-tyrosine sodium as artificial substrate, has zero activity relative to tyrosine as a substrate for tyrosine aminotransferase .
|
- HY-W048674
-
|
Fmoc-O-acetyl-L-serine
|
Amino Acid Derivatives
|
Infection
|
|
Fmoc-Ser(Ac)-OH (Fmoc-O-acetyl-L-serine) is a Serine derivative. Fmoc-Ser(Ac)-OH can be used for the preparation of broad-spectrum coronavirus membrane fusion inhibitor .
|
- HY-W048671
-
|
|
Amino Acid Derivatives
|
Others
|
|
Fmoc-Thr(TBDMS)-OH is a Threonine derivative. Fmoc-Thr(TBDMS)-OH can be used for the preparation of sugar ligand-tethered functional nucleic acid conjugates for targeted research .
|
- HY-W091734
-
|
|
Amino Acid Derivatives
|
Cardiovascular Disease
Neurological Disease
|
|
Methyl 4-iodo-L-phenylalaninate hydrochloride is a Phenylalaninate derivative. Methyl 4-iodo-L-phenylalaninate hydrochloride can be used for the preparation of factor XI modulators used in the research of thrombotic and thromboembolic. Methyl 4-iodo-L-phenylalaninate hydrochloride can also be used for the synthesis of compounds for the research of amyloid-related diseases, such as Alzheimer’s disease .
|
- HY-W007052
-
- HY-130189
-
|
|
Drug Metabolite
|
Others
|
|
S-Phenylmercapturic acid, a metabolite of benzene, can be used as a biomarker, identified by GC, HPLC (UV or fluorescence detection), GC-MS, LC-MS/MS or immunoassay .
|
- HY-W041988
-
|
|
Bacterial
|
Infection
|
|
Fmoc-Glu-OMe, a glutamic acid derivative, shows antibacterial activity and gelation property in AgNO3 solution. Fmoc-Glu-OMe is a mouldable wound healing biomaterial .
|
- HY-W009912
-
|
|
Amino Acid Derivatives
|
Others
|
|
H-Tyr(Me)-OH is a synthetic amino acid, and can enter into protein in E. coli in response to an amber nonsense codon .
|
- HY-W003605A
-
|
|
Amino Acid Derivatives
|
Others
|
|
1-Boc-DL-Pyroglutamic acid ethyl ester is a Boc-protected Pyroglutamic acid derivative, can be used for the synthesis of agents or other compounds .
|
- HY-W142161
-
|
Fmoc-MeHis(Trt)-OH
|
Amino Acid Derivatives
|
Others
|
|
Fmoc-N-Me-His(Trt)-OH (Fmoc-MeHis(Trt)-OH) is a is an amino acid derivative containing amino and carboxyl groups. Fmoc-N-Me-His(Trt)-OH for the synthesis of Fmoc-MeHis (Trt) -Leu-OH .
|
- HY-W142073
-
|
7-Methyltryptophan
|
Amino Acid Derivatives
|
Infection
|
|
7-Methyl-DL-tryptophan (7-Methyltryptophan) is an amino acid derivative, which is a key precursor for biosynthesis of many non-ribosomal peptide antibiotics. 7-Methyl-DL-tryptophan plays an important role in synthesis of high-efficiency antibacterial agents and analogues thereof .
|
- HY-W016012
-
|
|
Amino Acid Derivatives
|
Others
|
|
Glu-Glu is a glutamic acid derivative containing amino and carboxyl groups. Glu-Glu is an analogs of acidic tripeptide and can contribute to calcium absorption .
|
- HY-107663
-
|
Pro-Leu-Gly-NH2; Melanostatin
|
Dopamine Receptor
|
Neurological Disease
|
|
MIF-1 (Melanostatin), an endogenous brain peptide, is a potent dopamine receptor allosteric modulator. MIF-1 inhibits melanin formation. MIF-1 blocks the effects of opioid receptor activation to modulate the analgesic effects. MIF-1 accesses from the blood to the CNS by directly crossing the blood-brain barrier (BBB) .
|
- HY-W012906
-
|
L-Allylglycine
|
Peptides
|
Others
|
|
(S)-2-Allylglycine is a peptide derivative.
|
- HY-W142140
-
|
N-Methylvaline
|
Amino Acid Derivatives
|
Others
|
|
N-Methyl-DL-valine is a valine derivant, is metabolized to cysteine, alanine, tyrosine, tryptophan, citric acid, and succinic acid in the sprout. N-Methyl-DL-valine involves in the modification of monomethyl auristatin F (MMAF), an anti-tubulin agent, makes it hydrophobic functionalization and increases cell permeability .
|
- HY-W007599
-
|
|
Peptides
|
Cancer
|
|
(S)-2,6-Bis((tert-butoxycarbonyl)amino)hexanoic acid is a polypeptide derivative, can be used to synthesis multifunctional amphiphilic peptide dendrimer, as a nonviral gene vectors, realizes the method in cancer research. (S)-2,6-Bis((tert-butoxycarbonyl)amino)hexanoic acid also involves in the synthesis of an organic substance that increases the luminescence intensity of alkaline phosphatase substrates .
|
- HY-W111226
-
|
|
Amyloid-β
Amino Acid Derivatives
|
Cardiovascular Disease
|
|
Fmoc-His(3-Me)OH derives Histidine-associating compounds with biological activity. Fmoc-His(3-Me)OH, with Fmoc-citrulline-OH, Fmoc-His(1-Me)-OH together, forms tri-peptides and shows vasodilating effect with EC50s of 2.7-4.7 mM in 1.0 mM Phenylephrine (PE)-contracted aorta rings. Fmoc-His(3-Me)OH (resin) also makes Methyl-His-Gly-Lys (His(3-Me)-Gly-Lys), thus acts as an [Ca 2+]i inhibitor. Fmoc-His(3-Me)OH methylates NAHIS02, making it unable to block the Alzheimer's Aβ channel .
|
- HY-W072147
-
|
Fmoc-L-Ser-OMe
|
Amino Acid Derivatives
|
Others
|
|
Fmoc-Ser-OMe (Fmoc-L-Ser-OMe) is a hydroxylated L-amino acid protected with a 9-fluorenylmethyloxycarbonyl (Fmoc) group. Fmoc-Ser-OMe involves in chlorophyll–amino acid conjugates synthesis, and acts as a chromo/fluorophores modified protein and emits visible to near-infrared lights efficiently. Fmoc-Ser-OMe glycosylates and produces small mucin-related Olinked glycopeptides, as an alcohol acceptor .
|
- HY-W109513
-
|
|
Amino Acid Derivatives
|
Inflammation/Immunology
|
|
Boc-Lys(Z)-OH (DCHA) is a involves in synthesis thymosin β4, βg and β6 fragments, and increases E-rosette forming capacity in Lupus Nephritis model. Boc-Lys(Z)-OH (DCHA) involves in synthesis Boc-Lyz-OCH3 and acts as a reagent of peptidyl thrombin inhibitors production .
|
- HY-148031
-
|
|
ADC Linker
|
Others
|
|
MC-Ala-Ala-Asn-PAB-PNP is a peptide, can be used to synthesize specifically activated micromolecular target coupling body .
|
- HY-W013190
-
- HY-W015230
-
- HY-W008997
-
- HY-W008999
-
- HY-W009003
-
- HY-W009005
-
- HY-W009006
-
- HY-W009008
-
- HY-W009023
-
- HY-W009038
-
- HY-W009049
-
- HY-W009085
-
- HY-W009088
-
- HY-104004A
-
|
Fmoc-Ser-(GalNAc(Ac)3-beta-D)-OH; Fmoc-Ser[GalNAc(Ac)3-β-D]-OH; Fmoc-Ser(Ac3AcNH-β-Gal)-OH
|
Amino Acid Derivatives
|
Others
|
|
Fmoc-Ser(O-β-D-GalNAc(OAc)3)-OH is a serine derivative .
|
- HY-W009117
-
- HY-107848
-
- HY-W009124
-
- HY-113014
-
- HY-W009144
-
- HY-113214
-
- HY-W067091
-
- HY-W009197
-
- HY-W009211
-
- HY-118349
-
- HY-W009257
-
- HY-W009258
-
- HY-122526
-
- HY-W009260
-
- HY-128675
-
- HY-W009284
-
- HY-W009320
-
- HY-131894
-
- HY-W068839
-
- HY-134449
-
- HY-134450
-
- HY-W009328
-
- HY-134852
-
- HY-134935
-
- HY-W009337
-
- HY-135113
-
|
|
Amino Acid Derivatives
|
Others
|
|
Lanthionine is a cysteine derivative. Lanthionine is linked by a disulfide bond formed by an oxidation reaction between two cysteine residues .
|
- HY-137950
-
- HY-W009345
-
- HY-139128
-
- HY-W088097
-
- HY-W009381
-
- HY-W089229
-
- HY-15400
-
- HY-W092107
-
- HY-W009403
-
- HY-20153
-
- HY-20165
-
- HY-W097163
-
- HY-W009502
-
- HY-W098060
-
- HY-20561A
-
- HY-W009535
-
- HY-W099247
-
- HY-W009562
-
- HY-W014373
-
- HY-W009592A
-
- HY-W014375
-
- HY-20838B
-
- HY-20861
-
- HY-W014406
-
- HY-W102709
-
- HY-22296
-
- HY-W014505
-
- HY-W111209
-
- HY-W014599
-
- HY-23053
-
- HY-W111214
-
- HY-23122
-
- HY-W014742
-
- HY-W111969
-
- HY-W014786
-
- HY-23185
-
- HY-W014824
-
- HY-23424
-
- HY-W014916
-
- HY-W014917
-
- HY-W014919
-
- HY-W125501
-
- HY-W015177
-
- HY-30231
-
- HY-30232
-
- HY-W015231
-
- HY-W015233
-
- HY-32688
-
- HY-W128408
-
- HY-W015425
-
- HY-W129448
-
- HY-W129585
-
- HY-W130212
-
|
|
Amino Acid Derivatives
|
Others
|
|
(R)-2-((((9H-Fluoren-9-yl)methoxy)carbonyl)amino)-3-(2-(trifluoromethyl)phenyl)propanoic acid is a phenylalanine derivative .
|
- HY-W015651
-
- HY-W015926
-
- HY-W015946
-
- HY-W140881
-
- HY-W016018
-
- HY-W016031
-
- HY-W016075
-
- HY-41650
-
|
(S)-2-((tert-Butoxycarbonyl)amino)-N-methoxy-N-methylpropanamide; (S)-2-(tert-Butoxycarbonylamino)-N-methoxy-N-methylpropionamide
|
Amino Acid Derivatives
|
Others
|
|
Boc-Ala-NMe(OMe) is an alanine derivative .
|
- HY-W141779
-
- HY-W016319
-
- HY-W016336
-
- HY-42065
-
- HY-W141786
-
- HY-42069
-
- HY-W016425
-
- HY-42356
-
- HY-42364
-
- HY-42448
-
- HY-W016547
-
- HY-42757B
-
- HY-42938
-
- HY-W016552
-
- HY-42994
-
- HY-43459
-
- HY-W016555
-
- HY-43973
-
- HY-W016716
-
- HY-44070
-
- HY-W016731
-
- HY-59121
-
- HY-W016749
-
- HY-59135
-
- HY-W016948
-
- HY-59140
-
- HY-59260
-
- HY-60256
-
- HY-66024
-
- HY-W017202
-
- HY-W017254
-
- HY-75331
-
- HY-W017256
-
- HY-W009631
-
- HY-W017350
-
- HY-75401
-
- HY-W017404
-
- HY-75853
-
- HY-W009686
-
- HY-W017413
-
- HY-75947
-
- HY-W009770
-
- HY-76448
-
- HY-W009794
-
- HY-76962
-
- HY-W017788
-
- HY-77021
-
- HY-W009908
-
- HY-77132
-
- HY-W018077
-
- HY-W009913
-
- HY-W018238
-
- HY-W010028
-
- HY-W018366
-
- HY-W010077
-
- HY-W010156
-
- HY-W018489
-
- HY-W010197
-
- HY-77802
-
- HY-W018628
-
- HY-W010276
-
- HY-78105
-
- HY-W010277
-
- HY-W018741
-
- HY-W010324
-
- HY-W010366
-
- HY-W018865
-
|
(S)-Cysteine methyl ester hydrochloride; Methyl D-cysteinate hydrochloride
|
Amino Acid Derivatives
|
Others
|
|
Methyl D-cysteinate hydrochloride is a cysteine derivative .
|
- HY-78746A
-
|
|
Amino Acid Derivatives
|
Others
|
|
D-Proline, 3-(3-chloro-2-fluorophenyl)-4-(4-chloro-2-fluorophenyl)-4-cyano-5-(2,2-dimethylpropyl)-, (3S,4R,5S)-rel- is a proline derivative .
|
- HY-W010590
-
- HY-78897
-
- HY-W010591
-
- HY-W019684
-
- HY-W019714
-
- HY-W010714
-
- HY-W021299
-
- HY-W010719
-
- HY-79123
-
- HY-W010721
-
- HY-W021790
-
- HY-79130
-
|
Benzeneacetic acid, α-[[(9H-fluoren-9-ylmethoxy)carbonyl]amino]-, (S)-; (S)-2-[[[(9H-Fluoren-9-yl)methoxy]carbonyl]amino]phenylethanoic acid; (S)-N-Fmoc-α-phenylglycine; N-9-Fluorenylmethoxycarbonyl-L-phenylglycine
|
Amino Acid Derivatives
|
Others
|
|
Fmoc-(S)-phenylglycine is a Glycine (HY-Y0966) derivative .
|
- HY-79132
-
- HY-79271
-
|
Butanamide, 2-amino-N,3,3-trimethyl-, (S)-; (S)-2-amino-N-methyl-3,3-dimethylbutanamide; L-tert-Leucine methylamide; L-tert-Leucine-N-methylamide
|
Amino Acid Derivatives
|
Others
|
|
S-tert-Leucine N-methylamide is a leucine derivative .
|
- HY-W010747
-
- HY-79288
-
|
(S)-2-[(tert-Butoxycarbonyl)amino]-3-(3-fluorophenyl)propionic acid; tert-Butoxycarbonyl-L-3-fluorophenylalanine
|
Amino Acid Derivatives
|
Others
|
|
(2S)-2-[(tert-Butoxycarbonyl)amino]-3-(3-fluorophenyl)propionic acid is a phenylalanine derivative .
|
- HY-W010758
-
- HY-W141852
-
- HY-79333
-
- HY-79404
-
|
L-Leucine, N-[(1,1-dimethylethoxy)carbonyl]-4-methyl- (9CI); (S)-2-(tert-Butoxycarbonylamino)-4,4-dimethylpentanoic acid
|
Amino Acid Derivatives
|
Others
|
|
N-(Tert-Butoxycarbonyl)-L-neopentylglycine is a Glycine (HY-Y0966) derivative .
|
- HY-W010782
-
- HY-79415
-
- HY-79417
-
|
Carbamic acid, [(1S)-1-[(methoxymethylamino)carbonyl]-3-methylbutyl]-, 1,1-dimethylethyl ester (9CI); Carbamic acid, [1-[(methoxymethylamino)carbonyl]-3-methylbutyl]-, 1,1-dimethylethyl ester, (S)-
|
Amino Acid Derivatives
|
Others
|
|
(S)-N-Methyl-N-methoxy-2-(tert-butoxycarbonylamino)-4-methylpentanamide is a leucine derivative .
|
- HY-W010788
-
- HY-W010793
-
- HY-79680
-
|
|
Amino Acid Derivatives
|
Others
|
|
(S)-2-(tert-butoxycarbonylamino)-3-(4-carbamoyl-2,6-dimethylphenyl)propanoic acid is a phenylalanine derivative .
|
- HY-79708A
-
|
Methyl (R)-2-amino-3-methylbutanoate hydrochloride; Methyl D-valinate hydrochloride; NSC 22921
|
Amino Acid Derivatives
|
Others
|
|
O-Methyl-D-valine (hydrochloride) is a valine derivative .
|
- HY-79877
-
- HY-W010825
-
- HY-79919
-
|
|
Amino Acid Derivatives
|
Others
|
|
D-Phenylalanine, N-[N-[(1,1-dimethylethoxy)carbonyl]-D-leucyl]-, phenylmethyl ester is a phenylalanine derivative .
|
- HY-W010837
-
- HY-I0102
-
|
|
Amino Acid Derivatives
|
Others
|
|
(2S)-Methyl 2-(2-cyclohexyl-2-(pyrazine-2-carboxamido)acetamido)-3,3-dimethylbutanoate is a valine derivative .
|
- HY-W141889
-
- HY-I0109
-
- HY-I0115
-
|
|
Amino Acid Derivatives
|
Others
|
|
(S)-2-((S)-2-Cyclohexyl-2-(pyrazine-2-carboxamido)acetamido)-3,3-dimethylbutanoic acid is a valine derivative .
|
- HY-I0124
-
- HY-W141893
-
- HY-I0172
-
- HY-W010888
-
- HY-W141899
-
- HY-I0393
-
- HY-W010894
-
- HY-W010895
-
- HY-I0517
-
- HY-I0519
-
- HY-I0591
-
- HY-W010913
-
- HY-I0630
-
- HY-W010924
-
- HY-I0749A
-
|
|
Amino Acid Derivatives
|
Others
|
|
(S)-Methyl 2-((S)-2-((S)-2-amino-4-phenylbutanamido)-4-methylpentanamido)-3-phenylpropanoate 2,2,2-trifluoroacetate is a phenylalanine derivative .
|
- HY-I0775
-
|
|
Amino Acid Derivatives
|
Others
|
|
(S)-methyl 2-((S)-4-methyl-2-((S)-2-(2-morpholinoacetamido)-4-phenylbutanamido)pentanamido)-3-phenylpropanoate is a phenylalanine derivative .
|
- HY-W141910
-
- HY-I0917
-
- HY-W141911
-
- HY-I0924
-
- HY-W010957
-
- HY-I0924A
-
|
Methyl (R)-phenylalaninate hydrochloride; Methyl D-phenylalaninate hydrochloride
|
Amino Acid Derivatives
|
Others
|
|
D-Phe-OMe monohydrochloride is a phenylalanine derivative .
|
- HY-W010958
-
|
|
Amino Acid Derivatives
|
Others
|
|
(S)-2-((((9H-Fluoren-9-yl)methoxy)carbonyl)amino)-3-(3-cyanophenyl)propanoic acid is a phenylalanine derivative .
|
- HY-I1044
-
- HY-I1107
-
- HY-W141919
-
- HY-N2378
-
|
Benzenepropanoic acid, β-amino-α-hydroxy-, hydrochloride, (αR,βS)-
|
Amino Acid Derivatives
|
Others
|
|
(2R,3S)-3-Phenylisoserine hydrochloride is a serine derivative .
|
- HY-W141922
-
- HY-W000795
-
- HY-W000830
-
- HY-W141927
-
- HY-W000843
-
- HY-W141928
-
- HY-W001037
-
- HY-W141930
-
- HY-W141933
-
- HY-W141934
-
- HY-W001954
-
- HY-W002074
-
- HY-W002169
-
- HY-W002170
-
- HY-W002173
-
- HY-W002176
-
- HY-W002235
-
- HY-W141936
-
- HY-W002237
-
- HY-W002300
-
- HY-W002301
-
|
|
Amino Acid Derivatives
|
Others
|
|
(2S)-4-(benzyloxy)-2-{[(9H-fluoren-9-ylmethoxy)carbonyl]amino}-4-oxobutanoic acid is an aspartic acid derivative .
|
- HY-W002302
-
- HY-W002303
-
- HY-W002336
-
- HY-W141946
-
- HY-W022134
-
- HY-W022137
-
- HY-W002449
-
- HY-W002481
-
- HY-W002519
-
- HY-W022223
-
- HY-W002578
-
- HY-W002588
-
- HY-W022228
-
- HY-W003225
-
- HY-W141960
-
- HY-W003985
-
- HY-W141962
-
- HY-W141963
-
- HY-W004063
-
- HY-W004064
-
- HY-W004083
-
- HY-W022281
-
- HY-W004861
-
- HY-W022405
-
- HY-W005014
-
- HY-W005117
-
- HY-W022444
-
- HY-W005143
-
- HY-W005144
-
- HY-W022471
-
- HY-W022536
-
- HY-W005720
-
- HY-W005759
-
- HY-W005815
-
- HY-W022630
-
- HY-W005883
-
- HY-W141985
-
- HY-W022823
-
- HY-W005891
-
- HY-W023145
-
- HY-W141987
-
- HY-W023493
-
|
2-aminopent-4-enoic acid
|
Amino Acid Derivatives
|
Neurological Disease
|
|
DL-Allylglycine (2-Aminopent-4-enoic acid) is a glutamate decarboxylase (GAD) inhibitor. DL-Allylglycine has convulsant activity that can be used in studies to induce epileptic seizures .
|
- HY-W024554
-
- HY-W006062
-
- HY-W025807
-
- HY-W141990
-
- HY-W006152
-
- HY-W026072
-
- HY-W006185
-
- HY-W026894
-
- HY-W142000
-
- HY-W027230
-
- HY-W142003
-
- HY-W142008
-
- HY-W142009
-
- HY-W007020
-
- HY-W007108
-
- HY-W007136
-
- HY-W142019
-
- HY-W007399
-
- HY-W007408
-
- HY-W007573
-
- HY-W142023
-
- HY-W007578
-
- HY-W007615
-
- HY-W007706
-
- HY-W007720
-
- HY-W007722A
-
- HY-W007750
-
- HY-W007766
-
- HY-W142035
-
- HY-W007842
-
- HY-W007941
-
- HY-W008016
-
- HY-W142044
-
- HY-W008028
-
- HY-W008029
-
- HY-W008061
-
- HY-W008072
-
- HY-W008077
-
- HY-W008086
-
- HY-W008113
-
- HY-W008134
-
- HY-W032681
-
- HY-W032689
-
- HY-W142062
-
|
|
Amino Acid Derivatives
|
Others
|
|
cis-Fmoc-Pro(4-N3)-OH is a proline derivative . cis-Fmoc-Pro(4-N3)-OH is a click chemistry reagent, it contains an Azide group and can undergo copper-catalyzed azide-alkyne cycloaddition reaction (CuAAc) with molecules containing Alkyne groups. Strain-promoted alkyne-azide cycloaddition (SPAAC) can also occur with molecules containing DBCO or BCN groups.
|
- HY-W035914
-
- HY-W008156
-
- HY-W142081
-
- HY-W008176
-
- HY-W008178
-
- HY-W008179
-
- HY-W008182
-
- HY-W008183
-
- HY-W008196
-
- HY-W036320
-
|
|
Amino Acid Derivatives
|
Others
|
|
N2-(((9H-Fluoren-9-yl)methoxy)carbonyl)-Nw-((4-methoxy-2,3,6-trimethylphenyl)sulfonyl)-N2-methyl-L-arginine is an arginine derivative .
|
- HY-W036329
-
- HY-W037120
-
|
|
Amino Acid Derivatives
|
Others
|
|
N-(((9H-Fluoren-9-yl)methoxy)carbonyl)-S-((4-methoxyphenyl)diphenylmethyl)-D-cysteine is a cysteine derivative .
|
- HY-W008219
-
- HY-W037441
-
- HY-W008233
-
- HY-W008255
-
- HY-W008261
-
- HY-W008269
-
- HY-W142107
-
- HY-W008297
-
- HY-W008308
-
- HY-W038873
-
- HY-W008353
-
- HY-W142111
-
- HY-W039180
-
- HY-W142113
-
- HY-W039449
-
- HY-W039758
-
- HY-W039759
-
- HY-W039763
-
- HY-W008359
-
- HY-W039947
-
- HY-W040067
-
- HY-W008383
-
- HY-W040124
-
|
|
Amino Acid Derivatives
|
Others
|
|
DL-Propargylglycine is a Glycine (HY-Y0966) derivative . DL-Propargylglycine is a click chemistry reagent, it contains an Alkyne group and can undergo copper-catalyzed azide-alkyne cycloaddition (CuAAc) with molecules containing Azide groups.
|
- HY-W142126
-
- HY-W040333
-
- HY-W008386
-
- HY-W008395
-
|
|
Amino Acid Derivatives
|
Others
|
|
Fmoc-D-Pra-OH is a Glycine (HY-Y0966) derivative . Fmoc-D-Pra-OH is a click chemistry reagent, it contains an Alkyne group and can undergo copper-catalyzed azide-alkyne cycloaddition (CuAAc) with molecules containing Azide groups.
|
- HY-W008432
-
- HY-W008446
-
|
|
Amino Acid Derivatives
|
Others
|
|
(2S,4R)-4-((((9H-Fluoren-9-yl)methoxy)carbonyl)amino)-1-(tert-butoxycarbonyl)pyrrolidine-2-carboxylic acid is a proline derivative .
|
- HY-W142133
-
- HY-W008467
-
- HY-W008475
-
- HY-W008486
-
- HY-W008487
-
- HY-W008489
-
- HY-W008495
-
- HY-W008522
-
- HY-W008527
-
- HY-W008544
-
- HY-W008549
-
- HY-W008560
-
- HY-W008599
-
|
|
Amino Acid Derivatives
|
Others
|
|
(S)-2-Amino-3-methyl-N-(4-methyl-2-oxo-2H-chromen-7-yl)butanamide 2,2,2-trifluoroacetate is a valine derivative .
|
- HY-W008633
-
- HY-W142151
-
- HY-W008667
-
|
|
Amino Acid Derivatives
|
Others
|
|
(S)-2-((((9H-Fluoren-9-yl)methoxy)carbonyl)amino)-5-(tert-butoxy)-5-oxopentanoic acid hydrate is a glutamic acid derivative .
|
- HY-W040416
-
- HY-W008685
-
- HY-W040438
-
- HY-W008688
-
- HY-W040441
-
- HY-W008694
-
- HY-W040686
-
- HY-W142163
-
- HY-W008696
-
- HY-W040801
-
- HY-W008731
-
- HY-W040803
-
- HY-W040804
-
- HY-W041857
-
- HY-W008787
-
- HY-W008800
-
- HY-W041864
-
- HY-W041866
-
- HY-W041867
-
- HY-W041982
-
- HY-W142171
-
- HY-W041986
-
- HY-W008866
-
- HY-WAA0253
-
- HY-W008867
-
- HY-W008869
-
- HY-Y0029
-
- HY-W008872
-
- HY-Y0134
-
|
|
Amino Acid Derivatives
|
Others
|
|
(S)-2-((((9H-fluoren-9-yl)methoxy)carbonyl)amino)-5-(tert-butoxy)-5-oxopentanoic acid is a glutamic acid derivative .
|
- HY-W041997
-
- HY-Y0168
-
- HY-W008887
-
- HY-W042001
-
- HY-W042002
-
- HY-W042006
-
- HY-W042008
-
- HY-Y0555
-
- HY-W008942
-
- HY-W042010
-
- HY-W008958
-
- HY-W042013
-
- HY-Y0749A
-
|
Glutamic acid, dimethyl ester, hydrochloride, D-
|
Amino Acid Derivatives
|
Others
|
|
Dimethyl D-glutamate hydrochloride is a glutamic acid derivative .
|
- HY-Y0920
-
- HY-W042057
-
- HY-Y1166
-
- HY-W008986
-
- HY-Y1413
-
- HY-W008996
-
- HY-Y1789
-
- HY-Y1801
-
|
L-Aspartic acid β-methyl ester hydrochloride
|
Amino Acid Derivatives
|
Others
|
|
β-Methyl L-aspartate hydrochloride is an aspartic acid derivative .
|
- HY-Y1856
-
- HY-Y1875
-
- HY-Z0291
-
|
Isopropyl L-alaninate; L-Alanine 2-propyl ester; L-Alanine isopropyl ester; O-Isopropyl-L-alanine
|
Amino Acid Derivatives
|
Others
|
|
L-Alanine isopropyl ester is an alanine derivative .
|
- HY-Z0711
-
- HY-Z0790
-
- HY-Y1661
-
- HY-W042016
-
- HY-W008995
-
- HY-W008981
-
- HY-W043473
-
- HY-W008972
-
- HY-W008971
-
- HY-W044573
-
- HY-W044620
-
- HY-W008926
-
- HY-W045221
-
- HY-W046352
-
- HY-Y0555A
-
|
N-(Benzyloxycarbonyl)-D-leucine; N-Carbobenzoxy-D-leucine; N-Carbobenzyloxy-D-leucine; NSC 523826
|
Amino Acid Derivatives
|
Others
|
|
D-N-(Benzyloxycarbonyl)leucine is a leucine derivative .
|
- HY-W047794
-
- HY-W008771
-
- HY-W047845
-
- HY-W047901
-
- HY-WAA0112
-
- HY-Y0007
-
|
L-Alanine, N-carboxy-, N-benzyl ester (6CI,7CI); (S)-2-(Benzyloxycarbonylamino)propanoic acid
|
Amino Acid Derivatives
|
Others
|
|
N-[(Benzyloxy)carbonyl]-L-alanine is an alanine derivative .
|
- HY-W048203
-
- HY-W048207
-
- HY-W048215
-
|
|
Amino Acid Derivatives
|
Others
|
|
N2-(((9H-Fluoren-9-yl)methoxy)carbonyl)-N6-(2-(7-methoxy-2-oxo-2H-chromen-4-yl)acetyl)-L-lysine is a lysine derivative .
|
- HY-W048217
-
- HY-W048283
-
- HY-W048286
-
- HY-W008426
-
- HY-W008389
-
- HY-W048677
-
- HY-W008382
-
- HY-W008273
-
- HY-W048691
-
- HY-W048693
-
- HY-W048701
-
- HY-W008256
-
- HY-W048703
-
- HY-W048704
-
|
|
Amino Acid Derivatives
|
Others
|
|
N2-(((9H-Fluoren-9-yl)methoxy)carbonyl)-N6-((4-methoxyphenyl)diphenylmethyl)-L-lysine is a lysine derivative .
|
- HY-W008079
-
- HY-W048708
-
- HY-W008075
-
- HY-107373A
-
- HY-W048727
-
- HY-W048828
-
- HY-W010959
-
- HY-W048831
-
- HY-W010962
-
- HY-W048839
-
- HY-W010964
-
- HY-W048911
-
- HY-W010965
-
- HY-W048913
-
|
|
Peptides
|
Others
|
|
N2-(((9H-Fluoren-9-yl)methoxy)carbonyl)-N2-(2-((5-sulfonaphthalen-1-yl)amino)ethyl)-L-glutamine is a glutamine derivative .
|
- HY-W048918
-
- HY-W010982
-
- HY-W010997
-
- HY-W011000
-
- HY-W011001
-
- HY-W011003
-
- HY-W050494
-
- HY-W011019
-
- HY-W050785
-
- HY-W011026
-
- HY-W050803
-
- HY-W051093
-
- HY-W011033
-
- HY-W051350
-
- HY-W011049
-
- HY-W051418
-
- HY-W051568
-
- HY-W011056
-
- HY-W011064
-
- HY-W052212
-
- HY-W008908
-
- HY-W011074
-
- HY-W052246
-
- HY-W011081
-
- HY-W052309
-
- HY-W052310
-
- HY-W011088
-
- HY-W052493
-
- HY-W011089
-
- HY-W052529
-
- HY-W008371
-
- HY-W053503
-
|
|
Amino Acid Derivatives
|
Others
|
|
(S)-3-((tert-Butoxycarbonyl)amino)-3-(3-(trifluoromethyl)phenyl)propanoic acid is a phenylalanine derivative .
|
- HY-W053531
-
- HY-Y0028
-
|
N-(tert-Butoxycarbonyl)aspartic acid 1-benzyl ester; N-(tert-Butoxycarbonyl)aspartic acid benzyl ester
|
Amino Acid Derivatives
|
Others
|
|
(S)-2-(tert-Butoxycarbonylamino)succinic acid benzyl ester is an aspartic acid derivative .
|
- HY-79128
-
|
Fmoc-L-Lys(Boc)-OH; Fmoc-Lys(Boc)-OH; N-α-(Fmoc)-N-ε-(t-boc)-L-Lysine-OH
|
Amino Acid Derivatives
|
Others
|
|
Fmoc-L-Lys (Boc)-OH is a lysine derivative .
|
- HY-W011137
-
|
|
Peptides
|
Others
|
|
(S)-4-Nitrophenyl 4-amino-2-((tert-butoxycarbonyl)amino)-4-oxobutanoate is an asparagine derivative .
|
- HY-W011154
-
- HY-141526
-
- HY-W052408
-
- HY-W011167
-
- HY-W053705
-
- HY-W053801
-
- HY-W011199
-
- HY-W112057
-
- HY-W055811
-
- HY-W057434
-
- HY-W057465
-
- HY-W011203
-
- HY-W011210
-
|
|
Amino Acid Derivatives
|
Others
|
|
Fmoc-Pra-OH is a Glycine (HY-Y0966) derivative . Fmoc-Pra-OH is a click chemistry reagent, it contains an Alkyne group and can undergo copper-catalyzed azide-alkyne cycloaddition (CuAAc) with molecules containing Azide groups.
|
- HY-I1061
-
- HY-W011218
-
- HY-I0125
-
- HY-W011223
-
|
|
Amino Acid Derivatives
|
Others
|
|
(S)-2-((tert-Butoxycarbonyl)amino)-3-(4-(trifluoromethyl)phenyl)propanoic acid is a phenylalanine derivative .
|
- HY-W011255
-
- HY-W062304
-
- HY-W061650
-
- HY-W011321
-
- HY-W011322
-
- HY-W063269
-
- HY-W011325
-
- HY-W011337
-
- HY-W011342
-
- HY-W011324
-
- HY-W011354
-
- HY-W011391A
-
- HY-W011423
-
- HY-W011443
-
- HY-W011444
-
- HY-W011472
-
- HY-W011488
-
- HY-W011537
-
- HY-W011553
-
- HY-W011567
-
- HY-W011606
-
- HY-W011652
-
- HY-W011686
-
- HY-W011701
-
- HY-W011703
-
- HY-W011713
-
- HY-W011722
-
- HY-W011773
-
- HY-W011778
-
- HY-77584
-
|
|
Amino Acid Derivatives
|
Others
|
|
(2S,4R)-1-((S)-2-((tert-butoxycarbonyl)amino)non-8-enoyl)-4-hydroxypyrrolidine-2-carboxylic acid is a proline derivative .
|
- HY-W011830
-
- HY-W011832
-
- HY-W011892
-
- HY-W011903
-
- HY-W011913
-
- HY-W011931
-
- HY-W011977
-
- HY-W011983
-
|
|
Peptides
|
Others
|
|
5-Amino-2-((tert-butoxycarbonyl)amino)-5-oxopentanoic acid is a glutamine derivative .
|
- HY-W011992
-
- HY-W011993
-
- HY-W012002
-
- HY-W012003
-
- HY-W012030
-
- HY-W012064
-
- HY-W012075
-
- HY-W012098
-
- HY-W012104
-
- HY-W012133
-
- HY-W012137
-
- HY-W012138
-
- HY-W012139
-
- HY-W012214
-
- HY-W012220
-
|
|
Peptides
|
Others
|
|
(R)-4-Amino-2-((tert-butoxycarbonyl)amino)-4-oxobutanoic acid is an asparagine derivative .
|
- HY-W012228
-
- HY-W012255
-
- HY-W012379
-
- HY-W012381
-
- HY-W012437
-
- HY-W012446
-
- HY-W012451
-
- HY-W012485
-
- HY-W012486
-
- HY-W012487
-
- HY-W012497
-
- HY-W012519
-
- HY-W012537
-
- HY-W012676
-
- HY-W012705
-
- HY-W012706
-
- HY-W012707
-
- HY-W012709
-
- HY-W012713
-
- HY-W012791
-
- HY-W012850
-
- HY-W012871
-
- HY-W012872
-
- HY-W012873
-
- HY-W012883
-
- HY-W012889
-
- HY-W012907
-
- HY-W012921
-
- HY-W012966
-
- HY-W012967
-
- HY-W013048
-
- HY-W013083
-
- HY-W013108
-
|
|
Amino Acid Derivatives
|
Others
|
|
(S)-2-((((9H-Fluoren-9-yl)methoxy)carbonyl)amino)-3-(4-((tert-butoxycarbonyl)amino)phenyl)propanoic acid is a phenylalanine derivative .
|
- HY-W013118
-
- HY-W013143
-
- HY-41257
-
- HY-W013144
-
- HY-W013145
-
- HY-W011280
-
- HY-W011279
-
- HY-W011278
-
- HY-W013163
-
- HY-W013182
-
- HY-W013185
-
- HY-W011201
-
- HY-W053702
-
- HY-W011200
-
- HY-W053701
-
|
|
Amino Acid Derivatives
|
Others
|
|
N2-(((9H-Fluoren-9-yl)methoxy)carbonyl)-N6-((5-(dimethylamino)naphthalen-1-yl)sulfonyl)-L-lysine is a lysine derivative .
|
- HY-W013201
-
|
|
Amino Acid Derivatives
|
Others
|
|
(S)-1-((S)-2-Amino-4-methylpentanoyl)pyrrolidine-2-carboxylic acid compound with 2,2,2-trifluoroacetic acid (1:1) is a proline derivative .
|
- HY-W053699
-
- HY-W011186
-
- HY-W011178
-
- HY-W006923
-
- HY-W011135
-
- HY-W011126
-
- HY-W011116
-
|
|
Amino Acid Derivatives
|
Others
|
|
(S)-2-((S)-2-((S)-2-Amino-4-methylpentanamido)-4-methylpentanamido)-4-methylpentanoic acid is a leucine derivative .
|
- HY-W011084
-
- HY-W013291
-
- HY-W013292
-
- HY-W013293
-
- HY-W013297
-
- HY-W013300
-
- HY-W013305
-
- HY-W013322
-
- HY-W013373
-
- HY-W013406
-
- HY-W013416
-
- HY-W013286
-
- HY-W053550
-
- HY-W013239
-
- HY-W013517
-
- HY-W013210
-
- HY-W013207
-
- HY-W013198
-
- HY-W013638
-
- HY-W011359
-
- HY-W013162
-
- HY-W013155
-
- HY-W013652
-
- HY-W051351
-
- HY-W013659
-
- HY-W011021
-
- HY-W050493
-
- HY-W013678
-
- HY-W050023
-
- HY-W011002
-
- HY-W013714
-
- HY-W010984
-
- HY-W010976
-
- HY-W010974
-
- HY-W008360
-
- HY-W013734
-
- HY-W048334
-
- HY-W008464
-
- HY-W008529
-
- HY-W013740
-
- HY-W013745
-
- HY-W045072
-
- HY-W043423
-
- HY-W042000
-
- HY-W041999
-
- HY-W041996
-
- HY-W041992
-
- HY-W041991
-
- HY-W041990
-
- HY-W041987
-
- HY-W041985
-
- HY-W041862
-
- HY-W040723
-
- HY-W142162
-
- HY-W040432
-
- HY-W142156
-
- HY-W040024
-
- HY-W039695
-
- HY-W013774
-
- HY-W037443
-
- HY-W036352
-
- HY-W036333
-
- HY-W142093
-
- HY-W036324
-
- HY-W036322
-
- HY-W036222
-
- HY-W013844
-
- HY-W013850
-
- HY-W035886
-
- HY-W013874
-
- HY-W013905
-
- HY-W013923
-
- HY-W013940
-
- HY-W007986
-
- HY-W013968
-
- HY-W007942
-
- HY-W013998
-
- HY-W007931
-
- HY-W014048
-
- HY-W014097
-
- HY-W014100
-
- HY-W142030
-
- HY-W030573
-
- HY-W007679
-
- HY-W007620
-
- HY-W014258
-
|
|
Amino Acid Derivatives
|
Others
|
|
(R)-2-((tert-Butoxycarbonyl)amino)pent-4-ynoic acid is a Glycine (HY-Y0966) derivative . (R)-2-((tert-Butoxycarbonyl)amino)pent-4-ynoic acid is a click chemistry reagent, it contains an Alkyne group and can undergo copper-catalyzed azide-alkyne cycloaddition (CuAAc) with molecules containing Azide groups.
|
- HY-W030321
-
- HY-W014259
-
|
|
Amino Acid Derivatives
|
Others
|
|
(S)-2-((tert-Butoxycarbonyl)amino)pent-4-ynoic acid is a Glycine (HY-Y0966) derivative . (S)-2-((tert-Butoxycarbonyl)amino)pent-4-ynoic acid is a click chemistry reagent, it contains an Alkyne group and can undergo copper-catalyzed azide-alkyne cycloaddition (CuAAc) with molecules containing Azide groups.
|
- HY-W029652
-
- HY-W014303
-
- HY-W028991
-
- HY-W007354
-
- HY-W028793
-
- HY-W027829
-
- HY-W006205
-
- HY-W027251
-
- HY-W026508
-
- HY-W025811
-
- HY-W006093
-
- HY-W006063
-
- HY-W005913
-
- HY-W141986
-
- HY-W022796
-
- HY-W005846
-
- HY-W022593
-
- HY-W005388
-
- HY-W141975
-
- HY-W005295
-
- HY-W005226
-
- HY-W022447
-
- HY-W022446
-
- HY-W022404
-
- HY-W004153
-
- HY-W004110
-
- HY-W004098
-
- HY-W022250
-
- HY-W141961
-
- HY-W003499
-
- HY-W003318
-
- HY-W022227
-
- HY-W022226
-
- HY-W022220
-
- HY-W141949
-
- HY-W141948
-
- HY-W002436
-
- HY-W002416
-
- HY-W002410
-
- HY-W141945
-
- HY-W002326
-
- HY-W141942
-
- HY-W141940
-
- HY-W002294
-
- HY-W002236
-
- HY-W001210
-
- HY-W001158
-
- HY-N7403
-
- HY-N0473A
-
- HY-I1111
-
- HY-W141918
-
- HY-I0931
-
- HY-W141912
-
- HY-W010946
-
- HY-W010943
-
- HY-W010931
-
- HY-W010930
-
|
|
Amino Acid Derivatives
|
Others
|
|
(R)-2-((((9H-Fluoren-9-yl)methoxy)carbonyl)amino)-3-(4-chlorophenyl)propanoic acid is a phenylalanine derivative .
|
- HY-W010927
-
- HY-I0423
-
- HY-W010926
-
- HY-I0377
-
- HY-W141895
-
- HY-W010893
-
- HY-W010880
-
- HY-W010871
-
- HY-W141885
-
- HY-W010862
-
- HY-W010850
-
- HY-W010839
-
- HY-W141879
-
- HY-W010838
-
- HY-W010836
-
- HY-W010830
-
- HY-79676
-
- HY-W141862
-
- HY-79648
-
- HY-79513
-
|
tert-Butyl [(R)-1-(methoxycarbonyl)-2-hydroxyethyl]carbamate
|
Amino Acid Derivatives
|
Others
|
|
(R)-Methyl 2-(tert-butoxycarbonylamino)-3-hydroxypropanoate is a serine derivative .
|
- HY-W010811
-
- HY-W010794
-
- HY-79295
-
|
N-BOC-3-Fluoro-D-phenylalanine; N-tert-Butoxycarbonyl-3-fluoro-D-phenylalanine
|
Amino Acid Derivatives
|
Others
|
|
N-BOC-3-Fluoro-D-phenylalanine is a phenylalanine derivative .
|
- HY-W010785
-
- HY-79294
-
- HY-79165
-
- HY-W010770
-
- HY-79131
-
- HY-W141842
-
- HY-W010745
-
- HY-W010734
-
- HY-W010732
-
- HY-79106
-
|
[1,1'-Biphenyl]-4-propanoic acid, α-amino-, (S)-; 4-Biphenylyl-L-alanine; 4-Phenyl-L-phenylalanine; Biphenylalanine
|
Amino Acid Derivatives
|
Others
|
|
L-Biphenylalanine is a phenylalanine derivative .
|
- HY-W141835
-
- HY-79046
-
|
Butanoic acid, 2-[[(1,1-dimethylethoxy)carbonyl]amino]-, (S)-; Butyric acid, 2-(carboxyamino)-, N-tert-butyl ester, L- (8CI); (2S)-2-(tert-Butoxycarbonylamino)butanoic acid; (2S)-2-[[(1,1-Dimethylethoxy)carbonyl]amino]butanoic acid
|
Amino Acid Derivatives
|
Others
|
|
Boc-L-2-aminobutanoic acid is an alanine derivative .
|
- HY-78912
-
- HY-W010724
-
- HY-78907
-
- HY-W019683
-
- HY-78906
-
- HY-W019676
-
- HY-W141831
-
- HY-W019265
-
- HY-W019263
-
- HY-78843
-
- HY-W019028
-
- HY-78733
-
- HY-W010698
-
- HY-W018850
-
- HY-W018849
-
- HY-W018717
-
- HY-W141821
-
- HY-W018650
-
- HY-78008
-
- HY-77894
-
- HY-W018620
-
- HY-W018528
-
- HY-77801
-
- HY-W141817
-
- HY-77757
-
- HY-77630
-
- HY-W018420
-
- HY-W141815
-
- HY-W018386
-
- HY-W010249
-
- HY-77519
-
- HY-77151
-
- HY-W141812
-
- HY-W018062
-
- HY-77026
-
- HY-W018050
-
- HY-W018045
-
- HY-W017617
-
- HY-W017551
-
- HY-W009911
-
- HY-W017501
-
- HY-76205
-
- HY-W017499
-
- HY-W009892
-
- HY-76204
-
- HY-75949
-
- HY-W009841
-
- HY-W009840
-
- HY-W017406
-
- HY-W141795
-
- HY-75379
-
- HY-W009762
-
- HY-W009734
-
- HY-W009693
-
- HY-66026
-
- HY-66025
-
- HY-W009682
-
- HY-W009648
-
- HY-W017150
-
- HY-65000
-
- HY-60264
-
- HY-W009630
-
- HY-W017069
-
|
|
Amino Acid Derivatives
|
Others
|
|
(S)-3-((((9H-Fluoren-9-yl)methoxy)carbonyl)amino)-4-(allyloxy)-4-oxobutanoic acid is an aspartic acid derivative .
|
- HY-60040
-
- HY-W016996
-
- HY-W016835
-
- HY-W016427
-
- HY-W016426
-
- HY-W141791
-
- HY-W016423
-
- HY-W016363
-
- HY-W016342
-
- HY-W016340
-
- HY-W016339
-
- HY-W016035
-
- HY-W016032
-
- HY-W141770
-
- HY-W016028
-
- HY-W140794
-
- HY-W130397
-
|
|
Peptides
|
Others
|
|
(S)-2-((((9H-Fluoren-9-yl)methoxy)carbonyl)(methyl)amino)-4-oxo-4-(tritylamino)butanoic acid is an asparagine derivative .
|
- HY-W015595
-
- HY-W129587
-
- HY-W015533
-
- HY-W015465
-
- HY-W015457
-
- HY-W015359
-
- HY-W015279
-
- HY-W015241
-
- HY-W128037
-
- HY-W128028
-
- HY-W127783
-
- HY-30230
-
- HY-30090
-
- HY-23861
-
|
Fmoc-N,N-dimethyl-L-Glutamine
|
Peptides
|
Others
|
|
N2-(((9H-Fluoren-9-yl)methoxy)carbonyl)-N5,N5-dimethyl-L-glutamine is a glutamine derivative .
|
- HY-W014913
-
- HY-23174
-
- HY-W111382
-
- HY-W014663
-
- HY-W111211
-
- HY-W014553
-
- HY-22297
-
- HY-W110126
-
|
|
Amino Acid Derivatives
|
Others
|
|
(S)-3-((((9H-Fluoren-9-yl)methoxy)carbonyl)amino)-6-((tert-butoxycarbonyl)amino)hexanoic acid is a lysine derivative .
|
- HY-22062
-
- HY-W014418
-
- HY-22002
-
- HY-W014405
-
- HY-W099595
-
- HY-W099255
-
- HY-20838A
-
- HY-W099254
-
- HY-20838
-
- HY-20834
-
- HY-20582
-
- HY-W098273
-
- HY-20561
-
- HY-W098059
-
- HY-20167
-
- HY-W092115
-
- HY-W092111
-
- HY-W009534
-
- HY-W009503
-
- HY-W090626
-
- HY-W009477
-
- HY-141447
-
|
α-N-Carbobenzoxy-L-lysine thiobenzyl ester monohydrochloride
|
Amino Acid Derivatives
|
Others
|
|
Z-LYS-SBZL (monohydrochloride) is a lysine derivative .
|
- HY-W009412
-
- HY-W077223
-
- HY-W009402
-
- HY-W009392
-
- HY-W072598
-
- HY-W009379
-
- HY-W072177
-
- HY-W009343
-
- HY-W009339
-
- HY-131173
-
- HY-W009329
-
- HY-122811
-
- HY-W009322
-
- HY-W009321
-
- HY-W009262
-
- HY-115393
-
- HY-W067478
-
- HY-W067360
-
- HY-W009244
-
- HY-113119
-
- HY-111592
-
- HY-W009204
-
- HY-W009151
-
- HY-W009119
-
- HY-W009110
-
- HY-W007722
-
- HY-W014238
-
- HY-W007798
-
- HY-W007875
-
- HY-W014076
-
- HY-W008022
-
- HY-W014000
-
- HY-W013962
-
- HY-W013906
-
- HY-W142083
-
- HY-W142086
-
- HY-W013870
-
- HY-W013864
-
- HY-W013810
-
- HY-W037549
-
- HY-W038703
-
- HY-W142115
-
- HY-W013793
-
- HY-W013780
-
- HY-W013779
-
- HY-W042007
-
- HY-W042009A
-
- HY-W042478
-
- HY-W008977
-
- HY-W013769
-
- HY-W008733
-
- HY-W048668
-
- HY-W048680
-
- HY-W008254
-
- HY-W013760
-
- HY-W013749
-
- HY-W013735
-
- HY-W050444
-
- HY-W011020
-
- HY-W050782
-
- HY-W013719
-
- HY-W051299
-
- HY-W013686
-
- HY-W013280
-
- HY-W013651
-
- HY-W008379
-
- HY-W013622
-
- HY-W013460
-
- HY-W013241
-
- HY-W014329
-
- HY-W014304
-
- HY-W008021
-
- HY-W013824
-
- HY-W041984
-
- HY-W008530
-
- HY-W048681
-
- HY-W022138
-
- HY-W010775
-
- HY-W010209
-
- HY-151641
-
|
|
Peptides
|
Others
|
|
3-Azido-L-alanine is an aliphatic functionalized amino acid with side chain lengths of up to four carbons . 3-Azido-L-alanine is a click chemistry reagent, it contains an Azide group and can undergo copper-catalyzed azide-alkyne cycloaddition reaction (CuAAc) with molecules containing Alkyne groups. Strain-promoted alkyne-azide cycloaddition (SPAAC) can also occur with molecules containing DBCO or BCN groups.
|
- HY-148195
-
|
|
Peptides
|
Neurological Disease
|
|
NNZ 2591 is a synthetic analogue of a small peptide of cyclic glycine proline (cGP). NNZ 2591 shows orally active and cross the blood-brain barrier. NNZ 2591 shows neuroprotective after ischemic brain injury. NNZ 2591 improves motor function in a rat model of Parkinson's disease. NNZ 2591 has the potential for the research of ischemic brain injury and angelman syndrome .
|
- HY-138126
-
|
|
Peptides
|
Others
|
|
Dansyl-Tyr-Val-Gly is a substrate of peptidylglycine monooxygenase .
|
- HY-W212029
-
- HY-W007618
-
|
|
Peptides
|
Others
|
|
Boc-Lys-OH is a lysine derivative of azocyclic and anthraquinone. Boc-Lys-OH is a polypeptide-based heterofunctional linking molecule, which can be used as a biomarker reagent .
|
- HY-W013781
-
|
|
Peptides
|
Others
|
|
Boc-Glu(OBzl)-OH (Compound 9) is a glutamic acid derivative commonly used in Boc SPPS. Glutamic acid residues increase the hydrophilicity of the polypeptide and play an important structural and receptor binding role .
|
- HY-30216A
-
- HY-W587803
-
- HY-134161
-
|
|
Peptides
|
Metabolic Disease
|
|
DL-α-(Difluoromethyl)arginine is an potent, enzyme-activated and irreversible arginine decarboxylases inhibitor. DL-α-(Difluoromethyl)arginine blocks the arginine decarboxylase activity of E.coli and Pseudomonas aeruginosa in vivo .
|
- HY-113064
-
|
|
Endogenous Metabolite
|
Cancer
|
|
Selenocystine is a broad-spectrum anti-cancer agent. Selenocystine induces DNA damage in HepG2 cells, particularly in the form of DNA double strand breaks (DSBs). Selenocystine exhibits great promise as a therapeutic or adjuvant agent targeting DNA repair for cancer treatment .
|
- HY-114932
-
|
|
Peptides
|
Others
|
|
Linoleoyl phenylalanine is a kind of N-acyl phenylalanine.
|
- HY-115387
-
- HY-115411
-
|
|
Peptides
|
Others
|
|
L-Hydroxy arginine acetate is an intermediate in the catabolism of L-arginine .
|
- HY-117141
-
|
AGABA
|
Peptides
|
Others
|
|
N-Arachidonoyl-3-hydroxy-γ-aminobutyric acid is an arachidonoyl amino acid .
|
- HY-118535
-
- HY-119782
-
|
|
Fluorescent Dye
|
Others
|
|
L-Argininamide is a hydrophilic amino acid derivative and can be used as a compound for ligand binding DNA aptamers. L-Argininamide has the potential for fluorescent aptasensors development .
|
- HY-121520
-
- HY-121705
-
|
|
Endogenous Metabolite
|
Inflammation/Immunology
|
|
Propionyl-L-carnitine is a carnitine derivative and has a high affinity for muscular carnitine transferase. Propionyl-L-carnitine increases cellular carnitine content, thereby allowing free fatty acid transport into the mitochondria. Propionyl-L-carnitine alleviates the symptoms of PAD through a metabolic pathway, thereby improving exercise performance .
|
- HY-124081
-
|
|
Apoptosis
|
Metabolic Disease
|
|
N-Oleoyl-L-Serine is an endogenous amide of long-chain fatty acids with ethanolamine (N-acyl amides). N-Oleoyl-L-Serine is a lipid regulator of bone remodeling and stimulates osteoclast apoptosis. N-Oleoyl-L-Serine can be used for antiosteoporotic drug discovery development .
|
- HY-134124
-
|
|
Reactive Oxygen Species
|
Inflammation/Immunology
|
|
Glutathione ethyl ester is a cell-permeable GSH donor and provides an efficient supply of GSH to the oocyte. Glutathione ethyl ester shows positive effect on the in vitro production of embryos by enhancement of the antioxidative defense .
|
- HY-134141
-
|
|
Peptides
|
Metabolic Disease
|
|
5-Octyl hydrogen L-glutamate is cell-permeable molecule and can be used for synthesizing 5-octyl ester derivatives (5-octyl α-ketoglutarate) .
|
- HY-134445
-
- HY-134545
-
|
NALA
|
Peptides
|
Cancer
|
|
N-Arachidonoyl-L-alanine is an endocannabinoid analog with anti-cancer effects. N- Arachidonoyl-L-alanine kills HNSCC cells through 5-LO-mediated ROS productio .
|
- HY-137851
-
|
S-Pyruvylglutathione
|
Peptides
|
Others
|
|
S-lactoylglutathione is a serum metabolite and can be used as a potential marker for sensitivity of gastric cancer to neoadjuvant chemotherapy .
|
- HY-137946
-
|
|
Peptides
|
Others
|
|
L-Leucine 4-methoxy-β-naphthylamide hydrochloride is an aminopeptidase M and leucine aminopeptidase substrate .
|
- HY-138207
-
- HY-139006
-
|
|
TRP Channel
|
Neurological Disease
|
|
N-oleoyl-glutamine is a PM20D1-regulated N-acyl amino acids (NAAs). N-oleoyl-glutamine is a transient receptor potential (TRP) antagonist .
|
- HY-139093
-
|
|
Peptides
|
Others
|
|
Paracetamol-cysteine is a Paracetamol-cysteine Paracetamol protein adduct (PPA) and is formed when paracetamol is oxidized to the reactive metabolite N-acetyl-p-benzoquinoneimine (NAPQI) .
|
- HY-120731
-
- HY-137416
-
- HY-137529
-
- HY-145512
-
- HY-B1581
-
- HY-N7831
-
- HY-W009472
-
- HY-W011155
-
- HY-W012498
-
|
|
Peptides
|
Others
|
|
N-Acetylpenicillamine is acompounds derived from the amino acid penicillamine.
|
- HY-W015897
-
- HY-W017200
-
- HY-W017255
-
|
L-R-(3-Thieyl)glycie; L-α-3-Thieylglycie
|
Amino Acid Derivatives
|
Others
|
|
(S)-3-Thienylglycine (L-R-(3-Thieyl)glycie; L-α-3-Thieylglycie) is aamino acids and their derivatives.
|
- HY-W018502
-
- HY-W020826
-
- HY-W074889
-
- HY-W097491
-
- HY-W101377
-
- HY-W105740
-
- HY-W105804
-
- HY-W107585
-
- HY-W131398
-
- HY-W142080
-
- HY-W330469
-
- HY-W345421
-
- HY-W745139
-
- HY-W004114
-
- HY-P5750
-
|
|
Peptides
|
Neurological Disease
|
|
Hypertrehalosemic neuropeptide (Nauphoeta cinerea) is a neuropeptide in the adipokinetic hormone/red pigment-concentrating hormone (AKH/RPCH) family, and can stimulate the synthesis of trehalose .
|
- HY-W019599
-
- HY-100801A
-
|
|
Peptides
|
Others
|
|
DL-threo-3-Hydroxyaspartic acid is a glutamate uptake inhibitor that can block glutamate transport in cannulated sprague dawley rat .
|
- HY-W205320
-
- HY-W291634
-
- HY-136934
-
|
[Boc-Glu(Obzl)]2-Lys-Ome
|
P-glycoprotein
|
Cancer
|
|
Reversin 205 ([Boc-Glu(Obzl)]2-Lys-Ome) is a P-glycoprotein (ABCB1) inhibitor. Reversin 205 is a peptide chemosensitizer .
|
- HY-P2089
-
|
|
MMP
|
Others
|
|
Dnp-PYAYWMR is a peptide substrate that selectively targets MMP3. Dnp-PYAYWMR is cleaved by MMP3 to produce Dnp-PYA (nonfluorescent) and YWMR (fluorophore detectable at 360 nm). After incubation of MMP3 with Dnp-PYAYWMR for 2 h, MMP3 fluorescence intensity was measured. Ex/Em=328/350 nm .
|
- HY-P10036
-
|
|
PKG
|
Others
|
|
G-Subtide is a G-substrate peptide localized in Purkinje cells of the cerebellum. G-Subtide has little activity distinct from background and is a preferentially phosphorylated peptide substrate of recombinant PfPKG2 protein .
|
- HY-P10038
-
|
Myr-FEEERA-OH
|
Integrin
|
Infection
|
|
mP6 (Myr-FEEERA-OH) is a myristoylated peptide. mP6 inhibits the interaction of Gα13 with integrin β3 without disrupting talin-dependent integrin function. mP6 can block the GTP usage of Rac1, Rap1, and Rab7, effectively inhibiting the infection of CHO-A24 cells .
|
- HY-P10058
-
|
|
Biochemical Assay Reagents
|
Cancer
|
|
cpm-1285m is a cell-permeable mutated peptide analogue of cpm-1285 (Bcl-2 inhibitory peptide). cpm-1285m contains a single substitution of alanine for Leu-151, and exhibits a decrease in Bcl-2 binding affinity with a reduction in IC50 of ∼15-fold. cpm-1285m can be used as a control of cpm-1285 .
|
- HY-P10056
-
|
Human ezrin peptide (324-337)
|
HIV
|
Infection
|
|
HEP-1 (Human ezrin peptide (324-337)) is an orally active peptide with anti-HIV activity. HEP-1 enhances antibody titers generated by hepatitis B vaccination. HEP-1 has the potential to be studied against viral infections .
|
- HY-P10062
-
|
|
Biochemical Assay Reagents
|
Metabolic Disease
|
|
Hylambatin, a tachykinin, increases both plasma glucose and plasma insulin, whereas the secretion of glucagon was not affected. Hylambatin can be used in diabetes research .
|
- HY-P10043
-
|
|
Peptides
|
Others
|
|
MMP-1 Substrate is a matrix metalloproteinase-1 (MMP-1) selective substrate that can be used for the fluorometric determination of MMP-1 enzymatic activity .
|
- HY-P10046
-
|
|
Vasopressin Receptor
|
Metabolic Disease
|
|
[Deamino-Pen1,Val4,D-Arg8]-vasopressin (AVP-A) is an arginine-vasopressin (AVP) antagonist. AVP-A can significantly lower plasma aldosterone concentration in rats. AVP-A can be used for the research of the growth and steroidogenic capacity of rat adrenal zona glomerulosa .
|
- HY-P10051
-
|
|
Ras
Raf
|
Cancer
|
|
Cyclorasin 9A5 is an 11-residue cell-permeable cyclic peptide that orthosterically inhibits the Ras-Raf protein interaction with an IC50 of 120 nM .
|
- HY-P10052
-
|
|
VEGFR
|
Cancer
|
|
CBO-P11 specifically binds to receptor of VEGFR-2 and is used as targeting ligand for tumor angiogenesis. CBO-P11 is modified with a nearinfrared cyanine dye bearing an alkyne function, allowing both “click” coupling on azido-modified nanoparticles and fluorescence labelling .
|
- HY-P10053
-
|
|
Peptides
|
Metabolic Disease
|
|
sPLA2-IIA Inhibitor is a cyclic pentapeptide analog of FLSYK (cyclic 2-Nal-Leu-Ser-2-Nal-Arg (c2)), that binds to hGIIA (human IIA phospholipase A2) and inhibits its hydrolytic ability. sPLA2 is a member of the esterase superfamily that catalyzes the hydrolysis of the ester bond at the sn-2 position of glycerophospholipids, releasing free fatty acids such as arachidonic acid and lysophospholipids .
|
- HY-P10054
-
|
|
Peptides
|
Others
|
|
SGKtide is used as an SGK(Serum and glucocorticoid-inducible kinase) substrate .
|
- HY-P10055
-
|
PSMA-1
|
Peptides
|
Cancer
|
|
PSMA-1 is a PSMA targeting peptide (GRFLTGGTGRLLRIS) and can be used for for targeted delivery of glucose-regulated protein (GRP)-silencing siRNAs in PCa cells.?PSMA-1 is selected and polyarginine sequences R6?or R9?were added at the C terminus to generate the CTPs. FITC labeling of the peptide with an aminohexanoic acid (Ahx) linker at the N terminus produced FITC-PSMA-1, to track PSMA binding on PCa cells .?
|
- HY-P10057
-
|
|
Apoptosis
|
Cancer
|
|
cpm-1285 induces apoptosis by functionally blocking intracellular Bcl-2 and related death antagonists. cpm-1285 shows strong binding potency to Bcl-2 with an IC50 value of 130 nM. cpm-1285 reduces tumor burden in mice .
|
- HY-P10059
-
|
|
Peptides
|
Others
|
|
Boc-Val-Gly-Arg-βNA is a colorimetric substrate for plasminogen activator .
|
- HY-P10060
-
- HY-P10063
-
- HY-P10064
-
|
|
Peptides
|
Others
|
|
Akt Substrate (Akt/SKG substrate) is a 7 amino acid synthetic peptide suitable as a substrate for Akt .
|
- HY-P10065
-
- HY-P2682
-
|
|
MMP
|
Metabolic Disease
|
|
MMP-8/MMP-26 Fluorogenic substrate (DNP-Pro-Leu-Ala-Tyr-Trp-Ala-Arg) is a matrix metalloproteinase-8 (MMP-8) fluorogenic substrate. MMP-8/MMP-26 Fluorogenic substrate can be used for the research of atherosclerosis, pulmonary fibrosis, and sepsis .
|
- HY-P2689
-
|
|
Peptides
|
Others
|
|
DNP-PLGMWSR is a? fluorogenic substrate for MMP-2 and MMP-9 .
|
- HY-W040705
-
|
N-Methylanthranilic acid
|
Drug Metabolite
|
Others
|
|
2-(Methylamino)benzoic acid is the main metabolite of methyl-N-methylanthranilates (MMA) (HY-76705) and is the compound in which the ester group is converted. MMA can be isolated from citrus fruits and has potential analgesic activity. 2-(Methylamino)benzoic acid was used to detect the metabolic levels of MMA in rat liver .
|
- HY-P10050
-
|
|
Peptides
|
Others
|
|
Calpain substrate is the membrane non-permeable fluorogenic calpain substrate and can be used in Calpain enzymatic activity assay .
|
- HY-P10061
-
|
|
Cathepsin
|
Cancer
|
|
Cathepsin K inhibitor 4 is a potent carbohydrazide Cathepsin K inhibitor with IC50s of 13 nM, 269 nM, 296 nM for human, rat, mouse Cathepsin K, respectively .
|
- HY-126809
-
|
|
Peptides
|
Others
|
|
Chromozym PK is a Chromogenic Substrate and can be used in? Factor XII assay .
|
- HY-P4201
-
|
|
Vasopressin Receptor
|
Cardiovascular Disease
|
|
JKC 301 is a selective Endothelin A receptor antagonist. JKC 301 attenuates the pressor effects of nicotine in rats. JKC 301 can be used to study cardiovascular disease caused by smoking .
|
- HY-126169
-
- HY-W014168
-
- HY-W072732
-
|
Fmoc-N(Bn)-L-Ala-OH
|
Peptides
|
Others
|
|
N-(((9H-Fluoren-9-yl)methoxy)carbonyl)-N-benzyl-L-alanine is an alanine derivative .
|
- HY-W011374
-
- HY-W003991
-
- HY-W003903
-
|
|
Peptides
|
Others
|
|
Methyl 2-(benzylamino)-3-hydroxypropanoate is a serine derivative .
|
- HY-W053678
-
- HY-W142071
-
- HY-W060779
-
|
|
Peptides
|
Others
|
|
1-Benzyl 2-methyl (2R,4R)-4-hydroxypyrrolidine-1,2-dicarboxylate is a proline derivative .
|
- HY-W003903A
-
- HY-W010991
-
- HY-P0046
-
|
|
Peptides
|
Neurological Disease
Inflammation/Immunology
|
|
Glycyl-L-histidyl-L-lysine is a tripeptide consisting of glycine, L-histidine and L-lysine residues joined in sequence. Glycyl-L-histidyl-L-lysine is a hepatotropic immunosuppressor and shows anxiolytic effect. Glycyl-L-histidyl-L-lysine and its copper complexes show good skin tolerance .
|
- HY-W040074
-
|
Diglycine hydrochloride hydrate; Gly-Gly (HCl H2O)
|
Peptides
|
Others
|
|
Gly-GLY.HCl.H2O is a Glycine (HY-Y0966) derivative .
|
- HY-W142117
-
|
|
Fluorescent Dye
|
Others
|
|
H-Asp(AMC)-OH, a amino acid derivative, is a fluorescent dye. H-Asp(AMC)-OH dose not inhibit glycine transport at a concentration of 0.25 mM .
|
| Cat. No. |
Product Name |
Category |
Target |
Chemical Structure |
| Cat. No. |
Product Name |
Application |
Reactivity |
-
- HY-P82620
-
|
SLC1A1; EAAC1; EAAT3; Excitatory amino acid transporter 3; Excitatory amino-acid carrier 1; Neuronal and epithelial glutamate transporter; Sodium-dependent glutamate/aspartate transporter 3; Solute carrier family 1 member 1
|
WB, IHC-P, ICC/IF
|
Human, Mouse, Rat |
| Cat. No. |
Product Name |
|
Classification |
-
- HY-W006064
-
|
|
|
Alkynes
|
|
(S)-2-Aminopent-4-ynoic acid is a synthetic amino acid. (S)-2-Aminopent-4-ynoic acid can be used in synthesis of folate-conjugates and corresponding metal-chelate complexes . (S)-2-Aminopent-4-ynoic acid is a click chemistry reagent, it contains an Alkyne group and can undergo copper-catalyzed azide-alkyne cycloaddition (CuAAc) with molecules containing Azide groups.
|
-
- HY-W048205
-
|
|
|
Azide
|
|
N6-Diazo-L-Fmoc-lysine is an active compand and can be used in a variety of chemical studies. N6-Diazo-L-Fmoc-lysine is a click chemistry reagent, it contains an Azide group and can undergo copper-catalyzed azide-alkyne cycloaddition reaction (CuAAc) with molecules containing Alkyne groups. Strain-promoted alkyne-azide cycloaddition (SPAAC) can also occur with molecules containing DBCO or BCN groups.
|
-
- HY-W142062
-
|
|
|
Azide
|
|
cis-Fmoc-Pro(4-N3)-OH is a proline derivative . cis-Fmoc-Pro(4-N3)-OH is a click chemistry reagent, it contains an Azide group and can undergo copper-catalyzed azide-alkyne cycloaddition reaction (CuAAc) with molecules containing Alkyne groups. Strain-promoted alkyne-azide cycloaddition (SPAAC) can also occur with molecules containing DBCO or BCN groups.
|
-
- HY-W040124
-
|
|
|
Alkynes
|
|
DL-Propargylglycine is a Glycine (HY-Y0966) derivative . DL-Propargylglycine is a click chemistry reagent, it contains an Alkyne group and can undergo copper-catalyzed azide-alkyne cycloaddition (CuAAc) with molecules containing Azide groups.
|
-
- HY-W008395
-
|
|
|
Alkynes
|
|
Fmoc-D-Pra-OH is a Glycine (HY-Y0966) derivative . Fmoc-D-Pra-OH is a click chemistry reagent, it contains an Alkyne group and can undergo copper-catalyzed azide-alkyne cycloaddition (CuAAc) with molecules containing Azide groups.
|
-
- HY-W011210
-
|
|
|
Alkynes
|
|
Fmoc-Pra-OH is a Glycine (HY-Y0966) derivative . Fmoc-Pra-OH is a click chemistry reagent, it contains an Alkyne group and can undergo copper-catalyzed azide-alkyne cycloaddition (CuAAc) with molecules containing Azide groups.
|
-
- HY-W014258
-
|
|
|
Alkynes
|
|
(R)-2-((tert-Butoxycarbonyl)amino)pent-4-ynoic acid is a Glycine (HY-Y0966) derivative . (R)-2-((tert-Butoxycarbonyl)amino)pent-4-ynoic acid is a click chemistry reagent, it contains an Alkyne group and can undergo copper-catalyzed azide-alkyne cycloaddition (CuAAc) with molecules containing Azide groups.
|
-
- HY-W014259
-
|
|
|
Alkynes
|
|
(S)-2-((tert-Butoxycarbonyl)amino)pent-4-ynoic acid is a Glycine (HY-Y0966) derivative . (S)-2-((tert-Butoxycarbonyl)amino)pent-4-ynoic acid is a click chemistry reagent, it contains an Alkyne group and can undergo copper-catalyzed azide-alkyne cycloaddition (CuAAc) with molecules containing Azide groups.
|
-
- HY-151641
-
|
|
|
Azide
|
|
3-Azido-L-alanine is an aliphatic functionalized amino acid with side chain lengths of up to four carbons . 3-Azido-L-alanine is a click chemistry reagent, it contains an Azide group and can undergo copper-catalyzed azide-alkyne cycloaddition reaction (CuAAc) with molecules containing Alkyne groups. Strain-promoted alkyne-azide cycloaddition (SPAAC) can also occur with molecules containing DBCO or BCN groups.
|
Your information is safe with us. * Required Fields.
Inquiry Information
- Product Name:
- Cat. No.:
- Quantity:
- MCE Japan Authorized Agent:
![(2R)-2-[(3,5-Dinitrobenzoyl)<em>amino</em>]-2-phenyl-acetic acid](http://file.medchemexpress.com/product_pic/hy-w125501.gif)
acetic acid](http://file.medchemexpress.com/product_pic/hy-78105.gif)
![(2S)-2-[(tert-Butoxycarbonyl)<em>amino</em>]-3-(3-fluorophenyl)propionic acid](http://file.medchemexpress.com/product_pic/hy-79288.gif)
![L-Alanine, N-[(S)-(4-nitrophenoxy)phenoxyphosphinyl]-, 1-methylethyl ester](http://file.medchemexpress.com/product_pic/hy-79333.gif)
![D-Phenylalanine, N-[N-[(1,1-dimethylethoxy)carbonyl]-D-leucyl]-, phenylmethyl ester](http://file.medchemexpress.com/product_pic/hy-79919.gif)
![(2S)-4-(benzyloxy)-2-{[(9H-fluoren-9-ylmethoxy)carbonyl]<em>amino</em>}-4-oxobutanoic acid](http://file.medchemexpress.com/product_pic/hy-w002301.gif)
![N-[(9H-fluoren-9-ylmethoxy)carbonyl]-N-methylalanine](http://file.medchemexpress.com/product_pic/hy-w022134.gif)
![N-[(9H-Fluoren-9-ylmethoxy)carbonyl]-3-methoxy-L-phenylalanine](http://file.medchemexpress.com/product_pic/hy-w022228.gif)
![N-[4-(Morpholin-4-ylsulfonyl)benzoyl]glycine](http://file.medchemexpress.com/product_pic/hy-w027230.gif)
![N6-[(2E)-1-Oxo-2-buten-1-yl]-L-lysine](http://file.medchemexpress.com/product_pic/hy-w039947.gif)
![N-[(Phenylmethoxy)carbonyl]-L-leucine](http://file.medchemexpress.com/product_pic/hy-y0555.gif)
![N-[(Benzyloxy)carbonyl]-L-alanine](http://file.medchemexpress.com/product_pic/hy-y0007.gif)
![L-Alloisoleucine, N-[(phenylmethoxy)carbonyl]-](http://file.medchemexpress.com/product_pic/hy-i1061.gif)
![((4'-Chloro-[1,1'-biphenyl]-4-yl)sulfonyl)phenylalanine](http://file.medchemexpress.com/product_pic/hy-w030573.gif)
![1-[(3,5-Dimethylisoxazol-4-yl)sulfonyl]proline](http://file.medchemexpress.com/product_pic/hy-w026508.gif)
![(S)-2-<em>Amino</em>-3-(benzo[b]thiophen-3-yl)propanoic acid](http://file.medchemexpress.com/product_pic/hy-w022796.gif)
![N-[(9H-Fluoren-9-ylmethoxy)carbonyl]-O-(phenylmethyl)-D-serine](http://file.medchemexpress.com/product_pic/hy-w022226.gif)
![(2S)-2-[(tert-Butoxycarbonyl)<em>amino</em>]-3-(3,4-difluorophenyl)propionic acid](http://file.medchemexpress.com/product_pic/hy-79165.gif)
![Fmoc-Thr[PO(OBzl)OH]-OH](http://file.medchemexpress.com/product_pic/hy-w010770.gif)
![N-[(1,1-Dimethylethoxy)carbonyl]-L-leucyl-L-leucine](http://file.medchemexpress.com/product_pic/hy-78008.gif)
![N-[(9H-Fluoren-9-ylmethoxy)carbonyl]-5-methyl-L-norleucine](http://file.medchemexpress.com/product_pic/hy-22002.gif)
![N-[(9H-Fluoren-9-ylmethoxy)carbonyl]-O-(phenylmethyl)-L-serine](http://file.medchemexpress.com/product_pic/hy-w008977.gif)
![[Deamino-Pen1,Val4,D-Arg8]-vasopressin](http://file.medchemexpress.com/product_pic/hy-p10046.gif)
![N-[3-(2-Furyl)acryloyl]-Phe-Gly-Gly](http://file.medchemexpress.com/product_pic/hy-w010991.gif)
