Cagrilintide acetate

Name: Cagrilintide acetate
Brand: MedChemExpress
SKU: HY-P3462A
Rating: 4.5 (1 reviews)

Cat. No.: HY-P3462A Purity: 99.81%: FAQs
Data Sheet SDS COA Handling Instructions

Molarity Calculator

Cagrilintide acetate is a non-selective AMYR/CTR agonist and long-acting acylated amylase analogue. Cagrilintide acetate causes a reduction in food intake and significant weight loss in a dose-dependent manner. Cagrilintide acetate can be used in obesity studies.

For research use only. We do not sell to patients.

Custom Peptide Synthesis

Cagrilintide acetate Chemical Structure

Size	Price	Stock	Quantity
1 mg	USD 150	In-stock	Estimated Time of Arrival: December 31
5 mg	USD 450	In-stock	Estimated Time of Arrival: December 31
10 mg	USD 720	In-stock	Estimated Time of Arrival: December 31
50 mg		Get quote
100 mg		Get quote

or Bulk Inquiry

* Please select Quantity before adding items.

This product is a controlled substance and not for sale in your territory.

Customer Review

Based on 1 publication(s) in Google Scholar

Other Forms of Cagrilintide acetate:

Cagrilintide Get quote

Featured Recommendations

•Related Screening Libraries:

•Related Small Molecules:

•Related Proteins:

Biological Activity
Purity & Documentation
References
Customer Review

Description

IC₅₀ & Target

AMYR, CTR^[1]^[2]^[3].

In Vivo

Cagrilintide acetate (compound 23) (0.1, 1, 3, 10, 30 nmol/kg; s.c.single) reduces food intake in the rat^[1].
Cagrilintide acetate (10 nmol/kg; i.v. or s.c.; single) shows good pharmacokinetic parameters^[1].

MedChemExpress (MCE) has not independently confirmed the accuracy of these methods. They are for reference only.

Animal Model:	Sprague Dawley male rats (12-week-old; ~400 g)^[1]
Dosage:	0.1, 1, 3, 10, 30 nmol/kg
Administration:	Subcutaneous injection; single
Result:	Reduced food intake in the rat for several days at doses in the range of 1-10 nmol/kg.

Animal Model:	Sprague Dawley male rats (12-week-old; ~400 g)^[1]
Dosage:	10 nmol/kg
Administration:	Intravenous injection or subcutaneous injection; single
Result:	Showed good pharmacokinetic parameters with T_1/2 of 20, 27 h for i.v. and s.c., respectively.

Clinical Trial

Molecular Weight

4469.06

Formula

C₁₉₆H₃₁₆N₅₄O₆₁S₂

Appearance

Solid

Color

White to off-white

Sequence

{Eicosanedioic acid-γ-Glu}-Lys-Cys-Asn-Thr-Ala-Thr-Cys-Ala-Thr-Gln-Arg-Leu-Ala-Glu-Phe-Leu-Arg-His-Ser-Ser-Asn-Asn-Phe-Gly-Pro-Ile-Leu-Pro-Pro-Thr-Asn-Val-Gly-Ser-Asn-Thr-Pro-NH2 (Disulfide bridge:Cys3-Cys8)

Sequence Shortening

{Eicosanedioic acid-γ-Glu}-KCNTATCATQRLAEFLRHSSNNFGPILPPTNVGSNTP-NH2 (Disulfide bridge:Cys3-Cys8)

Shipping

Room temperature in continental US; may vary elsewhere.

Storage

Sealed storage, away from moisture and light, under nitrogen

Powder	-80°C	2 years
	-20°C	1 year

*In solvent : -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture and light, under nitrogen)

Solvent & Solubility

In Vitro:

DMSO : 100 mg/mL (22.38 mM; Need ultrasonic; Hygroscopic DMSO has a significant impact on the solubility of product, please use newly opened DMSO)

H₂O : 50 mg/mL (11.19 mM; Need ultrasonic)

Preparing
Stock Solutions

Concentration Solvent Mass	1 mg	5 mg	10 mg

1 mM	0.2238 mL	1.1188 mL	2.2376 mL
5 mM	0.0448 mL	0.2238 mL	0.4475 mL
10 mM	0.0224 mL	0.1119 mL	0.2238 mL

View the Complete Stock Solution Preparation Table

* Please refer to the solubility information to select the appropriate solvent. Once prepared, please aliquot and store the solution to prevent product inactivation from repeated freeze-thaw cycles.
Storage method and period of stock solution: -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture and light, under nitrogen). When stored at -80°C, please use it within 6 months. When stored at -20°C, please use it within 1 month.

* Note: If you choose water as the stock solution, please dilute it to the working solution, then filter and sterilize it with a 0.22 μm filter before use.

Molarity Calculator
Dilution Calculator

Mass (g) = Concentration (mol/L) × Volume (L) × Molecular Weight (g/mol)

Concentration _(start) × Volume _(start) = Concentration _(final) × Volume _(final)

This equation is commonly abbreviated as: C₁V₁ = C₂V₂

In Vivo Dissolution Calculator

Please enter the basic information of animal experiments:

Dosage

mg/kg

Animal weight
(per animal)

Dosing volume
(per animal)

μL

Number of animals

Recommended: Prepare an additional quantity of animals to account for potential losses during experiments.

Calculation results:

Working solution concentration: mg/mL

This product has good water solubility, please refer to the measured solubility data in water/PBS/Saline for details.

The concentration of the stock solution you require exceeds the measured solubility. The following solution is for reference only.If necessary, please contact MedChemExpress (MCE).

Purity & Documentation

Purity: 99.81%

Select Batch:

Data Sheet (273 KB) SDS (252 KB)

COA (245 KB) LCMS (98 KB) Elemental Analysis Report (102 KB)

Handling Instructions (2659 KB)

References

[1]. Kruse T, et al. Development of Cagrilintide, a Long-Acting Amylin Analogue. J Med Chem. 2021 Aug 12;64(15):11183-11194. [Content Brief]

[2]. Fletcher MM, et al. AM833 Is a Novel Agonist of Calcitonin Family G Protein-Coupled Receptors: Pharmacological Comparison with Six Selective and Nonselective Agonists. J Pharmacol Exp Ther. 2021 Jun;377(3):417-440. [Content Brief]

[3]. Dehestani B, et al. Amylin as a Future Obesity Treatment. J Obes Metab Syndr. 2021 Dec 30;30(4):320-325. [Content Brief]

Complete Stock Solution Preparation Table

Optional Solvent	Concentration Solvent Mass	1 mg	5 mg	10 mg	25 mg

H₂O / DMSO	1 mM	0.2238 mL	1.1188 mL	2.2376 mL	5.5940 mL
	5 mM	0.0448 mL	0.2238 mL	0.4475 mL	1.1188 mL
	10 mM	0.0224 mL	0.1119 mL	0.2238 mL	0.5594 mL
DMSO	15 mM	0.0149 mL	0.0746 mL	0.1492 mL	0.3729 mL
DMSO	20 mM	0.0112 mL	0.0559 mL	0.1119 mL	0.2797 mL

* Note: If you choose water as the stock solution, please dilute it to the working solution, then filter and sterilize it with a 0.22 μm filter before use.