Search Result

Results for "

MetS

" in MedChemExpress (MCE) Product Catalog:

By Targets:	c-Met/HGFR (119) ADC Antibody (1) Akt (3) Amino Acid Derivatives (15) Aminopeptidase (1) AMPK (1) Amyloid-β (2) Anaplastic lymphoma kinase (ALK) (8) Angiotensin Receptor (2) Angiotensin-converting Enzyme (ACE) (1) Antibiotic (3) Antibody-Drug Conjugates (ADCs) (1) Apoptosis (33) Autophagy (10) Bacterial (3) Beta-secretase (1) Biochemical Assay Reagents (1) Bombesin Receptor (1) Bradykinin Receptor (1) c-Fms (1) c-Kit (8) Cannabinoid Receptor (1) Casein Kinase (1) Caspase (1) CCR (1) CDK (1) CRFR (1) CXCR (1) Cytochrome P450 (1) Discoidin Domain Receptor (2) Drug-Linker Conjugates for ADC (2) E1/E2/E3 Enzyme (1) EGFR (6) Elastase (1) Endogenous Metabolite (4) FGFR (2) FLT3 (10) Formyl Peptide Receptor (FPR) (1) Fungal (1) Galectin (1) GCGR (1) HDAC (2) HIF/HIF Prolyl-Hydroxylase (1) IGF-1R (1) Insulin Receptor (1) Isotope-Labeled Compounds (4) MEK (1) MetAP (1) Mitochondrial Metabolism (2) MMP (1) Neurokinin Receptor (4) Opioid Receptor (9) P-glycoprotein (2) p38 MAPK (1) PARP (1) PDGFR (4) PI3K (1) Polo-like Kinase (PLK) (1) Potassium Channel (3) PROTACs (2) Protease Activated Receptor (PAR) (1) RAD51 (2) Raf (1) Reactive Oxygen Species (1) RET (2) RIP kinase (1) ROS Kinase (7) SARS-CoV (1) Small Interfering RNA (siRNA) (3) Src (1) TAM Receptor (17) TNF Receptor (1) Trk Receptor (3) Tyrosinase (1) VEGFR (21)
By Research Areas:	Cancer (141) Cardiovascular Disease (4) Endocrinology (5) Infection (5) Inflammation/Immunology (6) Metabolic Disease (15) Neurological Disease (25)
Click Chemistry:	Alkynes (2)

214

Inhibitors & Agonists

Screening Libraries

Peptides

Inhibitory Antibodies

Natural
Products

Isotope-Labeled Compounds

Click Chemistry

Targets Recommended: c-Met/HGFR

Cat. No.	Product Name	Target	Research Areas	Chemical Structure

HY-18309

MET kinase-IN-4	c-Met/HGFR VEGFR	Cancer
MET kinase-IN-4 is an orally active Met kinase inhibitor. MET kinase-IN-4 has potent Met kinase inhibitory activity with an IC₅₀ value of 1.9 nM. MET kinase-IN-4 can be used for the research of cancer .

HY-12019

SGX-523 5+ Cited Publications	c-Met/HGFR	Cancer
SGX523 is a exquisitely selective and ATP-competitive *MET* inhibitor. SGX523 potently inhibits MET with an IC₅₀ of 4 nM and is >1,000-fold selective versus other protein kinases. Antitumor activity .

HY-10949

SMER3	E1/E2/E3 Enzyme	Cancer
SMER3, a Rapamycin enhancer, is a selective Skp1-Cullin-F-box (SCF) ^Met30 ubiquitin ligase inhibitor. SMER3 enhances Rapamycin's growth inhibitory effect by inhibition of SCF ^Met30 .

HY-P990073

Davutamig REGN-5093	c-Met/HGFR	Cancer
Davutamig (REGN-5093) is a human immunoglobulin G4-kappa, *anti-MET* monoclonal antibody targeting two different nonoverlapping epitopes on MET. Davutamig is an antineoplastic .

HY-146884

MET kinase-IN-3	c-Met/HGFR VEGFR	Cancer
MET kinase-IN-3 (compound 8) is an orally active and potent *MET* inhibitor, with an IC₅₀ of 9.8 nM. MET kinase-IN-3 shows good and broad-spectrum antiproliferative activity against cancer cell lines .

HY-15456

NVP-BVU972	c-Met/HGFR	Cancer
NVP-BVU972 is an selective and potent *Met* inhibitor, with an IC₅₀ of 14 nM. NVP-BVU972 also exhibits good anti-proliferative activity against *Met* with drug-resistant mutations and inhibits phosphorylation. NVP-BVU972 can be used in study of cancer .

HY-147413

Unecritinib TQ-B3101	EGFR	Cancer
Unecritinib (TQ-B3101) is a potent EGFR tyrosine kinase inhibitor. Unecritinib shows anticancer activity. Unecritinib inhibits ALK, ROS1, and MET. Unecritinib has the potential for the research of solid tumor and relapsed or refractory ALK-positive anaplastic large cell lymphoma .

HY-P99250

Onartuzumab MetMAb	c-Met/HGFR	Cancer
Onartuzumab (MetMAb) is a unique, humanized and affinity-matured monovalent (one-armed) monoclonal antibody against the *MET* receptor. Onartuzumab potently inhibits HGF binding and receptor phosphorylation and signaling. Onartuzumab has antibody-like pharmacokinetics and antitumor activity .

HY-114357A

DS-1205b free base	TAM Receptor c-Met/HGFR Trk Receptor	Cancer
DS-1205b free base is a potent and selective inhibitor of AXL kinase, with an IC₅₀ of 1.3 nM. DS-1205b free base also inhibits MER, *MET, and TRKA, with IC₅₀*s of 63, 104, and 407 nM, respectively. DS-1205b free base can inhibit cell migration in vitro and tumor growth in vivo .

HY-162103

Axl-IN-18	TAM Receptor Apoptosis	Cancer
Axl-IN-18 (compound 25c) is a potent and selective type II AXL inhibitor. Axl-IN-18 shows excellent AXL inhibitory activity (IC₅₀=1.1 nM) and 343-fold selectivity over the highly homologous kinase MET in biochemical assays (IC₅₀=377 nM). Axl-IN-18 significantly inhibits AXL-driven cell proliferation, dose-dependently suppresses 4T1 cell migration and invasion, and induces apoptosis. Axl-IN-18 shows noticeable antitumor efficacy in a BaF3/TEL-AXL xenograft model .

HY-19642A

Glesatinib hydrochloride 2 Publications Verification MGCD265 hydrochloride	TAM Receptor c-Met/HGFR	Cancer
Glesatinib hydrochloride (MGCD265 hydrochloride) is an orally active, potent *MET/SMO* dual inhibitor. Glesatinib hydrochloride, a tyrosine kinase inhibitor, antagonizes P-glycoprotein (P-gp) mediated multidrug resistance (MDR) in non-small cell lung cancer (NSCLC) .

HY-19642

Glesatinib MGCD265	TAM Receptor c-Met/HGFR	Cancer
Glesatinib (MGCD265) is an orally active, potent *MET/SMO* dual inhibitor. Glesatinib, a tyrosine kinase inhibitor, antagonizes P-glycoprotein (P-gp) mediated multidrug resistance (MDR) in non-small cell lung cancer (NSCLC) .

HY-18696

AMG-337	c-Met/HGFR Caspase Apoptosis	Cancer
AMG-337 is a potent, orally active, selective MET kinase inhibitor with IC₅₀ values of 1, 1, 4.7, 5, 21.5, 1077 and >4000 nM of WT MET, H1094R MET, M1250T MET, HGF-stimulated pMET (PC3 cells) MET, V1092I MET, Y1230H MET, and D1228H MET, respectively. AMG 337 inhibits the phosphorylation of MET and downstream effectors in MET-amplified cancer cell lines, resulting in an inhibition of MET-dependent cell proliferation and induction of apoptosis .

HY-148279

c-Met-IN-15

c-Met/HGFR Cancer

c-Met-IN-15 (compound S3) is a c-Met kinase inhibitor. c-Met-IN-15 inhibits c-Met kinase activity of 21.1% at the concentration of 10 μM .

*c-Met-IN-15*	c-Met/HGFR	Cancer
c-Met-IN-15 (compound S3) is a *c-Met* kinase** inhibitor. c-Met-IN-15 inhibits c-Met kinase activity of 21.1% at the concentration of 10 μM .

HY-150576

*c-Met-IN-13*	c-Met/HGFR	Cancer
c-Met-IN-13 is a potent *c-Met* inhibitor with an IC₅₀ value of 2.43 nM. c-Met-IN-13 shows excellent cytotoxicity for cancer cells. c-Met-IN-13 shows antiproliferative activity in a concentration- and time- dependent manner. c-Met-IN-13 has the potential for the research of cancer .

HY-161353

*c-Met-IN-23*	c-Met/HGFR P-glycoprotein	Cancer
c-Met-IN-23 (Compound 12g) is a *c-Met* inhibitor (IC₅₀ = 0.052 μM for c-Met). c-Met-IN-23 also inhibits MDR1 and MRP1/2 pumps in the cancerous HepG2 and BxPC3 cells. c-Met-IN-23 is an anticancer agent .

HY-15959

Savolitinib 5 Publications Verification Volitinib; HMPL-504; AZD-6094	c-Met/HGFR	Cancer
Savolitinib (AZD-6094) is a potent, highly selective, and orally bioavailable *c-Met* inhibitor with IC₅₀s of 5 nM and 3 nM for c-Met and p-Met, respectively. Savolitinib (AZD-6094) selectively binds to and inhibits the activation of c-Met in an ATP-competitive manner, and disrupts c-Met signal transduction pathways. Antineoplastic activity .

HY-157387

*c-Met-IN-22*	c-Met/HGFR Apoptosis	Cancer
c-Met-IN-22 (compound 51am) is an orally active inhibitor against *c-Met* with an IC₅₀ value of 2.54 nM. c-Met-IN-22 has antiproliferative and antitumor activities. c-Met-IN-22 induces cell apoptosis .

HY-149880

*c-Met-IN-18*	c-Met/HGFR	Cancer
c-Met-IN-18 is ATP competitive type-III c-MET inhibitor of WT and D1228V mutant c-MET. c-Met-IN-18 has inhibitory for WT/D1228V with an IC₅₀ value of 0.013/0.20 ^e.c-Met-IN-18 can be used for the research of c-MET driven cancers . c-Met-IN-18 is a click chemistry reagent, it contains an Alkyne group and can undergo copper-catalyzed azide-alkyne cycloaddition (CuAAc) with molecules containing Azide groups.

HY-149510

MET/PDGFRA-IN-1	c-Met/HGFR Apoptosis PDGFR	Cancer
MET/PDGFRA-IN-1 (compound 8c) is a *MET* and PDGFRA protein inhibitor (IC₅₀: 36 μM for MET). MET/PDGFRA-IN-1 inhibits MET phosphorylation and induces cell apoptosis. MET/PDGFRA-IN-1 inhibits proliferation of MET-positive cells (IC₅₀s: 15.3, 19.0, 22.0, 25.6, 21.0, 31.5 μM for AsPc-1, EBC-1, MKN-45, Mia-Paca-2, HT-29, K562 cells respectively) .

HY-149360

P-gb-IN-1	P-glycoprotein	Cancer
P-gb-IN-1 (compound Ⅲ-8), a 2,5-disubstituted furan derivative, is a highly effective, broadspectrum P-glycoprotein (P-gp) inhibitor. P-gb-IN-1 displayed the reversal activity by inhibiting P-gp efflux. P-gb-IN-1 has a potent affinity to P-gp by forming H-bond interactions with residues Asn 721 and Met 986. P-gb-IN-1 possesses broad-spectrum reversal activity and low toxicity in MCF-7/ADR cells .

HY-131065

MET kinase-IN-2

c-Met/HGFR Cancer

MET kinase-IN-2 is a potent, selective, orally bioavailable MET kinase inhibitor with an IC₅₀ of 7.4 nM. MET kinase-IN-2 has antitumor activity .
HY-139132

Met-F-AEA

Apoptosis Cancer

Met-F-AEA is a metabolically stable anandamine analogue. Met-F-AEA inhibits cell growth by activating apoptosis. Met-F-AEA has antitumor activity .
HY-W008371S2

Fmoc-Met-OH-d3

Isotope-Labeled Compounds Others

Fmoc-Met-OH-d₃ is the deuterium labeled Fmoc-Met-OH.

MET kinase-IN-2	c-Met/HGFR	Cancer
MET kinase-IN-2 is a potent, selective, orally bioavailable MET kinase inhibitor with an IC₅₀ of 7.4 nM. MET kinase-IN-2 has antitumor activity .

Met-F-AEA	Apoptosis	Cancer
Met-F-AEA is a metabolically stable anandamine analogue. Met-F-AEA inhibits cell growth by activating apoptosis. Met-F-AEA has antitumor activity .

*Fmoc-Met-OH-d3*	Isotope-Labeled Compounds	Others
Fmoc-Met-OH-d₃ is the deuterium labeled Fmoc-Met-OH.

HY-163006

*EGFR/c-Met-IN-1*	EGFR c-Met/HGFR	Cancer
EGFR/c-Met-IN-1 (compound TS-41) is a dual-target inhibitor of *EGFR/c-Met. The IC₅₀ for inhibiting EGFR ^L858R and c-Met* is 68.1 nM and 0.26 nM respectively. . EGFR/c-Met-IN-1 induces apoptosis and cell cycle arrest in A549-P cells, downregulating the phosphorylation of EGFR, c-Met, and downstream AKT. EGFR/c-Met-IN-1 inhibits tumor growth in vitro and in vivo .

HY-120908

c-Met-IN-16

c-Met/HGFR Cancer

c-Met-IN-16 is a c-Met inhibitor that can be used for cancer research .

*c-Met-IN-16*	c-Met/HGFR	Cancer
c-Met-IN-16 is a *c-Met* inhibitor that can be used for cancer research .

HY-115937

*c-Met-IN-9*	c-Met/HGFR Apoptosis	Cancer
c-Met-IN-9, a 4-phenoxypyridine derivative, is a *c-Met* kinas inhibitor with an IC₅₀** of 12 nM. c-Met-IN-9 induces cells apoptosis, and has antitumor activities .

HY-161141

*EGFR/c-Met-IN-2*	c-Met/HGFR	Cancer
EGFR/ C-Met-in-2 (Compound H-22) is a dual inhibitor of *EGFR/c-Met. EGFR/c-Met-IN-2 inhibits cell proliferation by arresting G2/M phase. EGFR/c-Met*-IN-2 has antitumor activity .

HY-W008371S

Fmoc-Met-OH-15N

Isotope-Labeled Compounds Others

Fmoc-Met-OH- ¹⁵N is the ¹⁵N labeled Fmoc-Met-OH[1].
HY-150013

H-Met-Met-OH

L-Methionyl-L-methionine
Others Others

H-Met-Met-OH (L-Methionyl-L-methionine) is a dipeptide composed of two methionine residues .
HY-P4356

D-Met-Met

Amino Acid Derivatives Others

D-Met-Met is an orally active methionine dipeptide and has potential applications in food supplements .

*Fmoc-Met-OH-15N*	Isotope-Labeled Compounds	Others
Fmoc-Met-OH- ¹⁵N is the ¹⁵N labeled Fmoc-Met-OH[1].

*H-Met-Met-OH* L-Methionyl-L-methionine	Others	Others
H-Met-Met-OH (L-Methionyl-L-methionine) is a dipeptide composed of two methionine residues .

D-Met-Met	Amino Acid Derivatives	Others
D-Met-Met is an orally active methionine dipeptide and has potential applications in food supplements .

HY-150582

*c-Met-IN-14*	c-Met/HGFR c-Kit FLT3 Apoptosis	Cancer
c-Met-IN-14 (compound 26af) is a selective inhibitor of *c-Met* kinase from N-sulfonylamidine-based derivatives, with an IC₅₀ value of 2.89 nM. c-Met-IN-14 shows anticancer activity by blocking phosphorylation of c-Met, and arrests cell cycle at G2/M phase. c-Met-IN-14 induces apoptosis of A549 cells in a dose-dependent manner .

HY-124267

Zgwatinib SOMG-833	c-Met/HGFR	Cancer
Zgwatinib (SOMG-833) is a potent, selective, and ATP-competitive *c-MET* inhibitor, with an IC₅₀ of 0.93 nM against c-MET, over 10,000-fold more potent compared with 19 tyrosine kinases (including c-MET family members and highly homologous kinases). Zgwatinib potently inhibits c-MET-driven cell proliferation. Zgwatinib as a potential candidate agent for c-MET-driven human cancers research .

HY-143462

*c-Met/HDAC-IN-2*	HDAC c-Met/HGFR Apoptosis	Cancer
c-Met/HDAC-IN-2 is a highly potent *c-Met* and HDAC dual inhibitor with IC₅₀s of 18.49 nM and 5.40 nM for HDAC1 and *c-Met, respectively. c-Met/HDAC-IN-2 has antiproliferative activities against certain cancer cell lines. c-Met/HDAC-IN-2 can cause G2/M-phase arrest and induce apoptosis* in HCT-116. c-Met/HDAC-IN-2 can be used for researching anti-cancer resistance .

HY-150004

*c-Met/HDAC-IN-3*	c-Met/HGFR HDAC Apoptosis	Cancer
c-Met/HDAC-IN-3 (Compound 15f) is a dual *c-Met* and HDAC inhibitor with IC₅₀ values of 12.50 nM and 26.97 nM against c-Met and HDAC1, respectively. c-Met/HDAC-IN-3 induces apoptosis and cause cell cycle arrest in G2/M phase .

HY-147695

*c-Met-IN-12*	c-Met/HGFR	Cancer
c-Met-IN-12 (compound 4r) is an orally active, potent and selective type II *c-Met* kinase inhibitor, with an IC₅₀ of 10.6 nM. c-Met-IN-12 displays high inhibitory effects (inhibition rate > 80% in 1 μM) against AXL, Mer and TYRO3 kinases. c-Met-IN-12 can be used a scaffold for further kinase selectivity enhancement. c-Met-IN-12 shows antitumor efficacy .

HY-157824

6Lac[6]Met

Galectin Metabolic Disease Cancer

6Lac[6]Met is a galectin 4 inhibitor with an IC₅₀ value 5 μM .

6Lac[6]Met	Galectin	Metabolic Disease Cancer
6Lac[6]Met is a galectin 4 inhibitor with an IC₅₀ value 5 μM .

HY-153831

*c-Met-IN-17*	c-Met/HGFR	Cancer
c-Met-IN-17 is a potent *c-Met* kinase inhibitor with an IC₅₀ of 0.031 μM. c-Met-IN-17 can be used in anticancer research. . c-Met-IN-17 is a click chemistry reagent, it contains an Alkyne group and can undergo copper-catalyzed azide-alkyne cycloaddition (CuAAc) with molecules containing Azide groups.

HY-P1467

*[Met5]-Enkephalin, amide* 5-Methionine-enkephalin amide	Opioid Receptor	Neurological Disease
[Met5]-Enkephalin, amide is an agonist for δ opioid receptors as well as putative ζ ζ opioid receptors.

HY-101773

c-Met-IN-2

c-Met/HGFR Cancer

c-Met-IN-2 is a potent, selective and orally available c-Met inhibitor, with an IC₅₀ of 0.6 nM, with antitumor activity.

*c-Met-IN-2*	c-Met/HGFR	Cancer
c-Met-IN-2 is a potent, selective and orally available *c-Met* inhibitor, with an IC₅₀ of 0.6 nM, with antitumor activity.

HY-P4191

Met-RANTES (human) MSPYSSDTTPCCFAYIARPLPRAHIKEYFYTSGKCSN	CCR	Others
Met-RANTES (human) is a partial antagonist of CCR5. Met-RANTES (human) reduces the infiltration of blood monocytes into the liver .

HY-101031

c-Met-IN-1

c-met-IN-1 (compound 16) is a potent and selective c-Met inhibitor, with IC₅₀ of 1.1 nM, with antitumor activity. .

*c-Met-IN-1*
c-met-IN-1 (compound 16) is a potent and selective *c-Met* inhibitor, with IC₅₀ of 1.1 nM, with antitumor activity. .

HY-P1467A

*[Met5]-Enkephalin, amide TFA* 5-Methionine-enkephalin amide TFA	Opioid Receptor	Neurological Disease
[Met5]-Enkephalin, amide TFA is an agonist for δ opioid receptors as well as putative ζ ζ opioid receptors.

HY-147259

Dalmelitinib	c-Met/HGFR	Cancer
Dalmelitinib is an orally active selective *c-Met* kinase inhibitor (IC₅₀: 2.9 nM) that binds to the ATP-binding region of c-Met. Dalmelitinib induces the phosphorylation of MET, partially or completely inhibits the phosphorylation of AKT and ERK. Dalmelitinib potently inhibits cancer cell (c-Met oncogene amplification) proliferation, and is used for the research of cancers like human non-small cell lung cancer (NSCLC) .

HY-149674

VEGFR-2/c-Met-IN-1

VEGFR Cancer

VEGFR-2/c-Met-IN-1 is a dual inhibitoe of VEGFR-2 and c-Met with IC₅₀s of 138 nM and 74 nM, respectively. VEGFR-2/c-Met-IN-1 has antitumor activity .

*VEGFR-2/c-Met-IN-1*	VEGFR	Cancer
VEGFR-2/c-Met-IN-1 is a dual inhibitoe of VEGFR-2 and *c-Met* with *IC₅₀s of 138 nM and 74 nM, respectively. VEGFR-2/c-Met-IN-1 has antitumor activity .*

HY-149511

MET/PDGFRA-IN-2	c-Met/HGFR Apoptosis PDGFR	Cancer
MET/PDGFRA-IN-2 (compound 8h) is a *MET* and PDGFRA protein inhibitor. MET/PDGFRA-IN-2 induces cell apoptosis. MET/PDGFRA-IN-2 inhibits proliferation of MET-positive cells (IC₅₀s: 9.7, 6.1, 12.0, 11.5, 8.6, 34.4 μM for AsPc-1, EBC-1, MKN-45, Mia-Paca-2, HT-29, K562 cells respectively) .

HY-15735

*c-Met* inhibitor 1**	c-Met/HGFR	Cancer
c-Met inhibitor 1 is an inhibitor of the c-Met receptor signaling pathway useful for the treatment of cancer including gastric, glioblastoma, and pancreatic cancer.

HY-157302

c-Met-IN-21

c-Met/HGFR Cancer

c-Met-IN-21 (compound 54) is a c-met inhibitor with an IC₅₀ value of 0.45? nM, and shows anti-tumor efficacy in vivo .

HY-P3548

*[D-Ala2]-Met-Enkephalinamide*	Opioid Receptor	Neurological Disease
[D-Ala2]-Met-Enkephalinamide, an opioid peptide, is a potent opioid agonist. [D-Ala2]-Met-Enkephalinamide decreases bile flow by a central mechanism. [D-Ala2]-Met-Enkephalinamide has analgesic properties .

HY-P4439

*H-Met-Val-OH*	Amino Acid Derivatives	Neurological Disease
H-Met-Val-OH is a dipeptide containing free N-terminal methionine. H-Met-Val-OH exhibits activity against cDNA expressing Flavin-containing monooxygenase (FMO) 1 and FMO3. H-Met-Val-OH has potential applications in the growth of neuritis .

Cat. No.	Product Name

HY-L039

Reprogramming Compound Library

2080 compounds

Techniques for reprogramming somatic cells create new opportunities for drug screening, disease modeling, artificial organ development, and cell therapy. The development of reprogramming techniques has grown exponentially since Yamanaka reprogrammed somatic cells to become induced pluripotent stem cells (iPSCs) using four transcription factors, OCT4, SOX2, KLF4, and c-MYC in 2006. Despite the development of efficient reprogramming methods, most methods are inappropriate for clinical applications because they carry the risk of integrating exogenous genetic factors or use oncogenes. Alternative approaches, such as those based on miRNA, non-viral genes, non-integrative vectors, and small molecules, have been studied as possible solutions to the problems. Among these alternatives, small molecules are attractive options for clinical applications. Reprogramming using small molecules is inexpensive and easy to control in a concentration- and time-dependent manner. It offers a high level of cell permeability, ease of synthesis and standardization, and it is appropriate for mass-producing cells.

MCE Reprogramming Compound Library contains a unique collection of 2080 compounds that act on reprogramming signaling pathways. These compounds are potential stimulators for reprogramming. This library is a useful tool for researching reprogramming and regenerative medicine.

HY-L016

Protein Tyrosine Kinase Compound Library

1064 compounds

Protein tyrosine kinases (PTKs) are key signaling molecules and important drug targets. Two classes of PTKs are present in cells: the transmembrane receptor PTKs (RTKs) and the nonreceptor PTKs. The RTK family includes the receptors for insulin and for many growth factors, such as EGFR, FGFR, PDGFR, VEGFR, and NGFR. RTKs are transmembrane glycoproteins that are activated by the binding of their ligands, and they transduce the extracellular signal to the cytoplasm by phosphorylating tyrosine residues on the receptors themselves (autophosphorylation) and on downstream signaling proteins. Their principal functions of PTKs involve the regulation of multicellular aspects of the organism. Cell to cell signals concerning growth, differentiation, adhesion, motility, and death are frequently transmitted through tyrosine kinases. In humans, tyrosine kinases have been demonstrated to play significant roles in the development of many disease states, including diabetes and cancers.

MCE designs a unique collection of 1064 compounds that act as a useful tool for PTKs-related drug screening and disease research.

HY-L101

Anti-Liver Cancer Compound Library

1828 compounds

Liver cancer is one of the leading malignancies which occupies the second position in cancer deaths worldwide, becoming serious threat to human health. Hepatocellular carcinoma (HCC), also known as hepatoma is the most common type accounting for approximately 90% of all liver cancers.

Current evidence indicates that during hepatocarcinogenesis, two main pathogenic mechanisms prevail: (1) cirrhosis associated with hepatic regeneration after tissue damage caused by hepatitis infection, toxins or metabolic influences, and (2) mutations occurring in single or multiple oncogenes or tumor suppressor genes. Both mechanisms have been linked with alterations in several important cellular signaling pathways. These include the RAF/MEK/ERK pathway, PI3K/AKT/mTOR pathway, WNT/b-catenin pathway, insulin-like growth factor pathway, c-MET/HGFR pathway , etc.

MCE offers a unique collection of 1828 compounds with identified and potential anti-liver cancer activity. MCE anti-liver cancer compound library is a useful tool for anti-liver cancer drugs screening and other related research.

Cat. No.	Product Name	Target	Research Area

HY-P99391

Telisotuzumab ABT-700	Inhibitory Antibodies	Cancer
Telisotuzumab (ABT-700) is a human recombinant bivalent antibody, a therapeutic antibody against the hepatocyte growth factor receptor (MET) that binds c-Met with high affinity and inhibits c-Met signaling. Telisotuzumab has antitumor activity .

HY-P99250

Onartuzumab MetMAb	c-Met/HGFR	Cancer
Onartuzumab (MetMAb) is a unique, humanized and affinity-matured monovalent (one-armed) monoclonal antibody against the *MET* receptor. Onartuzumab potently inhibits HGF binding and receptor phosphorylation and signaling. Onartuzumab has antibody-like pharmacokinetics and antitumor activity .

HY-P99196

Ficlatuzumab	c-Met/HGFR	Cancer
Ficlatuzumab is a monoclonal antibody (McAb) targeting human hepatocyte growth factor (HGF). Ficlatuzumab blocks the activation of the *HGF/c-Met* signaling pathway, and inhibits *c-Met* receptor-mediated cancer cell proliferation, migration, and invasion .

HY-P99192

Emibetuzumab LY2875358	c-Met/HGFR	Cancer
Emibetuzumab (LY2875358) is a humanized bivalent *MET* antibody (IgG4 type). Emibetuzumab shows high neutralization and internalization activities, resulting in inhibition of both HGF-dependent and HGF-independent *MET* pathway activation and tumor growth. Emibetuzumab can be used in study of cancer .

HY-P990073

Davutamig REGN-5093	c-Met/HGFR	Cancer
Davutamig (REGN-5093) is a human immunoglobulin G4-kappa, *anti-MET* monoclonal antibody targeting two different nonoverlapping epitopes on MET. Davutamig is an antineoplastic .

HY-P990306

ABBV-303	c-Met/HGFR ADC Antibody	Cancer
ABBV-303 is a multi-specific NK cell antibody targeting *c-Met* designed based on TriNKET technology for natural killer (NK) cell redirection therapy. The ABBV-303 antibody consists of three functional arms, a single-chain variable fragment (scFV) targeting c-Met, a Fab arm targeting NKG2D, and an Fc fragment targeting NK cell CD16a .

HY-P99217

Rilotumumab AMG 102	c-Met/HGFR	Cancer
Rilotumumab (AMG 102) is an anti-HGF (anti-hepatocyte growth factor) monoclonal antibody, inhibits HGF/MET-driven signaling. Rilotumumab shows anti-tumor activity, and can be used in castration-resistant prostate cancer (CRPC) and solid tumor research .

HY-P9977

Amivantamab 1 Publications Verification JNJ-61186372	EGFR	Cancer
Amivantamab (JNJ-61186372) is a human *EGFR-MET* bispecific antibody with immune anticancer activity. Amivantamab inhibits ligand binding, promotes endocytosis and degradation of receptor-antibody complexes, and induces Fc-dependent cytokinesis in macrophages and antibody-dependent cytotoxicity in natural killer cells .

Cat. No.	Product Name	Category	Target	Chemical Structure

HY-W016647

*For-Met-OH* N-Formylmethionine	Structural Classification Classification of Application Fields Ketones, Aldehydes, Acids Source classification Metabolic Disease Endogenous metabolite Disease Research Fields	Endogenous Metabolite
For-Met-OH is an endogenous metabolite.

HY-P1904

*Phe-Met-Arg-Phe Like Peptide, Snail Helix aspersa*	Natural Products Animals Source classification	Others
Phe-Met-Arg-Phe Like Peptide, Snail Helix aspersa is a FMRF-like peptide from visceral and somatic muscles of the snail Helix aspersa. FMRF (Phe-Met-Arg-Phe) is a neuropeptide peptide consisting of 4 amino acid residues .

HY-N6797

Meleagrin	Infection Alkaloids Microorganisms Classification of Application Fields Source classification Disease Research Fields Indole Alkaloids	Bacterial c-Met/HGFR Antibiotic
Meleagrin is a roquefortine C-derived alkaloid produced by fungi of the genus Penicillium and has antimicrobial and anti-proliferative activities. Meleagrin is a class of FabI inhibitor. Meleagrin is a lead *c-Met* inhibitory entity useful for the control of c-Met-dependent metastatic and invasive breast malignancies .

HY-W010104

L-Methionine sulfoxide H-Met(O)-OH	Classification of Application Fields Ketones, Aldehydes, Acids Source classification Metabolic Disease Endogenous metabolite Disease Research Fields	Endogenous Metabolite
L-Methionine sulfoxide (H-Met(O)-OH), a metabolite of Methionine, induces M1/classical macrophage polarization, and modulates oxidative stress and purinergic signaling parameters .

HY-P4196

Met-Enkephalin-Arg-Phe	Structural Classification Monophenols Source classification Phenols Endogenous metabolite	Others
Met-Enkephalin-Arg-Phe is a naturally occurring heptapeptide with analgesic activity .

HY-N10219

Dihydroaltenuene B	Infection Monophenols Microorganisms Classification of Application Fields Source classification Phenols Disease Research Fields	Tyrosinase Fungal
Dihydroaltenuene B is a potent mushroom tyrosinase inhibitor with an IC₅₀ of 38.33 µM. Dihydroaltenuene B shows the hydrogen bonding interactions between the 3-OH and 4’-OH and the His244, Met280 and Gly281 residues of tyrosinase .

Cat. No.	Product Name	Chemical Structure

HY-W008371S2

Fmoc-Met-OH-d3

Fmoc-Met-OH-d₃ is the deuterium labeled Fmoc-Met-OH.

HY-50878S

Crizotinib-d5

Crizotinib-d₅ is the deuterium labeled Crizotinib. Crizotinib (PF-02341066) is an orally bioavailable, ATP-competitive ALK and c-Met inhibitor with IC₅₀s of 20 and 8 nM, respectively. Crizotinib inhibits tyrosine phosphorylation of NPM-ALK and tyrosine phosphorylation of c-Met with IC₅₀s of 24 and 11 nM in cell-based assays, respectively. Crizotinib is also a ROS1 inhibitor. Crizotinib has effective tumor growth inhibition .

HY-W008371S

Fmoc-Met-OH-15N

Fmoc-Met-OH- ¹⁵N is the ¹⁵N labeled Fmoc-Met-OH[1].
HY-W008371S1

Fmoc-Met-OH-13C5,15N

Fmoc-Met-OH- ¹³C₅, ¹⁵N is a ¹⁵N-labeled and ¹³C-labled Fmoc-L-Val-OH[1].

HY-50878AS

Crizotinib-d9 hydrochloride

Crizotinib-d₉ hydrochloride is deuterated labeled Crizotinib hydrochloride (HY-50878A). Crizotinib hydrochloride (PF-02341066 hydrochloride) is an orally bioavailable, selective, and ATP-competitive dual ALK and c-Met inhibitor with IC₅₀s of 20 and 8 nM, respectively. Crizotinib hydrochloride (PF-02341066 hydrochloride) inhibits tyrosine phosphorylation of NPM-ALK and tyrosine phosphorylation of c-Met with IC₅₀s of 24 and 11 nM in cell-based assays, respectively. It is also a ROS proto-oncogene 1 (ROS1) inhibitor. Crizotinib hydrochloride (PF-02341066 hydrochloride) has effective tumor growth inhibition .

HY-50683S

JNJ-38877605-d1
JNJ-38877605-d1 (compound DO-2) is a highly selective MNNG HOS transforming (MET) inhibitor. JNJ-38877605-d1 is thought to diminish the formation of the Aldehyde Oxidase 1 inactive metabolite M3 .

HY-13016S1

Cabozantinib-d4
Cabozantinib-d₄ is deuterium labeled Cabozantinib. Cabozantinib is a potent multiple receptor tyrosine kinases (RTKs) inhibitor that inhibits VEGFR2, c-Met, Kit, Axl and Flt3 with IC50s of 0.035, 1.3, 4.6, 7 and 11.3 nM, respectively.

HY-13016S

Cabozantinib-d6
Cabozantinib-d₆ is the deuterium labeled Cabozantinib. Cabozantinib is a potent multiple receptor tyrosine kinases (RTKs) inhibitor that inhibits VEGFR2, c-Met, Kit, Axl and Flt3 with IC50s of 0.035, 1.3, 4.6, 7 and 11.3 nM, respectively[1][2][3].

Inquiry Online

Your information is safe with us. * Required Fields.

MCE Japan Authorized Agent ナミキ商事株式会社コスモ・バイオ株式会社
Salutation			Country or Region *
Applicant Name *			Organization Name *
Department *
Email Address *			Product Name *
Cat. No.			Requested quantity *
Phone Number *
Remarks