2. Search Result
Search Result
Results for "

peptide sequence

" in MedChemExpress (MCE) Product Catalog:

220

Inhibitors & Agonists

1

Screening Libraries

3

Fluorescent Dyes

13

Biochemical Assay Reagents

243

Peptides

4

Inhibitory Antibodies

1

Natural
Products

3

Click Chemistry

9

Oligonucleotides

Cat. No. Product Name Target Research Area
  • HY-P5282
    ApoA-I mimetic peptide

    		Acyltransferase Cardiovascular Disease Metabolic Disease
    ApoA-I mimetic peptide is an ApoA-I mimetic peptide. ApoA-I mimetic peptide has good phosphatidylcholine: cholesterol acyltransferase (LCAT) activation activity. ApoA-I mimetic peptide can be used to synthesize peptide/lipid complexes. ApoA-I mimetic peptide can be used in atherosclerosis research. (The sequence is: PVLDLFRELLNELLEALKQKLK) .
  • HY-P3211B
    Nangibotide scrambled peptide
    2 Publications Verification

    LR12-scr

    		 TREM receptor Inflammation/Immunology
    Nangibotide scrambled peptide (LR12-scr) is a scrambled control peptide composed of the same amino acids from LR12 (Nangibotide; HY-P3211) but in a random sequence (YQDVELCETGED) .
  • HY-W1124925
    DOTA-GPC3 targeting peptide 2

    		Radionuclide-Drug Conjugates (RDCs) Glycoprotein VI Cancer
    DOTA-GPC3 targeting peptide 2 (Sequence 30) is a RDC peptide targeting GPC3, with Kd of 0.3 nM. DOTA-GPC3 targeting peptide 2 is composed of DOTA and GPC3 targeting peptide 2. DOTA-GPC3 targeting peptide 2 can be labeled with radioactive elements .
  • HY-P4093
    Cys-Penetratin

    		Biochemical Assay Reagents Others
    Cys-Penetratin is a cysteine-containing cell-penetrating peptide with sequence CRQIKIWFQNRRMKWKK. Cys-Penetratin can Cys-Penetratin can be used for the research for the research of drug delivery .
  • HY-P3732
    RGD-4C

    		Integrin Cancer
    RGD-4C is a arginine-glycine-aspartic acid peptide (ACDCRGDCFC) with integrin binding activity. The Arg-Gly-Asp (RGD) sequence serves as the primary integrin recognition site in extracellular matrix proteins, and peptides containing this sequence can mimic the recognition specificity of the matrix proteins. RGD-4C is a αv-integrin ligand, can conjugate with bioactive molecule to exert antitumor effects in animal models .
  • HY-P3051
    CKS-17

    		Reverse Transcriptase Inflammation/Immunology
    CKS-17 is a synthetic retroviral envelope peptide. CKS-17 has the highly conserved amino acid sequences occurring within the transmembrane envelope protein of many animal and human retroviruses. CKS-17 acts as an immunomodulatory epitope and exhibits suppressive properties for numerous immune functions .
  • HY-P5217
    CSTSMLKAC (disulfide)

    		Peptides Others
    CSTSMLKAC (peptide 2) is a cyclic 9 amino acid sequence that mimics endogenous peptide sequences. CSTSMLKAC homes to cardiomyocytes in the ischemic myocardium .
  • HY-P2193
    TAT-amide

    		Peptides Infection
    TAT-amide is a cell penetrating peptide. Cell-penetrating peptides (CPPs) are short amino acid sequences able to enter different cells .
  • HY-P11094
    Tet1-Cys peptide

    		TET Protein Neurological Disease
    Tet1-Cys peptide is a peptide with the sequence HLNILSTLWKYRC. Tet1 (HLNILSTLWKYR) (HY-P10998) can specifically bind to the neuronal ganglioside receptor GT1b, possessing neuronal targeting capabilities. The Tet1-Cys peptide sequence has an added Cys, which can be used for drug conjugation for research on drug delivery .
  • HY-P0315
    Crosstide
    2 Publications Verification

    		 Akt Others
    Crosstide is a peptide analog of glycogen synthase kinase α/β fusion protein sequence which is a substrate for Akt.
  • HY-P10787
    tLyP-1 peptide

    		Complement System Cancer
    tLyP-1 peptide is an NRP-1 targeting peptide with an IC50 of 4 μM, and its amino acid sequence is CGNKRTR. tLyP-1 peptide specifically binds to NRP-1 to target tumor cells .
  • HY-P5353
    PA22-2

    IKVAV sequence; Laminin A-chain fragment

    		 Peptides Others
    PA22-2 (IKVAV sequence; Laminin A-chain fragment) is a biological active peptide. (This peptide is derived from mouse laminin a1 . Cell matrix substrate constituted with this peptide can promote neurite outgrowth.)
  • HY-P5124
    β-Amyloid peptide(16-20)

    KLVFF

    		 Amyloid-β Neurological Disease
    β-Amyloid peptide(16-20) is a amino acid sequences (KLVFF) of Amyloid-β (Abeta). β-Amyloid peptide(16-20) is an effective inhibitor of Abeta fibril formation, with RG-/-GR-NH2 residues added at N- and C-terminal ends to aid solubility) .
  • HY-P4425
    Gly-Phe-AMC

    		Biochemical Assay Reagents Others
    Gly-Phe-AMC is a fluorogenic peptide substrate consisting of a peptide sequence composed of glycine and phenylalanine, linked to the fluorophore AMC. Gly-Phe-AMC also serves as a cathepsin C substrate. Gly-Phe-AMC is widely used to detect the activity of various proteases .
  • HY-P10709A
    CREKA peptide acetate

    		Biochemical Assay Reagents Cardiovascular Disease Cancer
    CREKA peptide acetate is a short peptide sequence, belonging to self-assembling peptides (SAPs), which can self-assemble into functional nanostructures, typically nanofibers, under physiological conditions. CREKA peptide acetate can be used to target tumor cells and tumor vasculature, exhibiting antitumor activity .
  • HY-136727
    Ac-LEVD-CHO
    1 Publications Verification

    		 Caspase Cancer
    Ac-LEVD-CHO is a caspase-4 inhibitor. Ac-LEVD-CHO is a peptide with the sequence of Ac-Leu-Glu-Val-Asp-al .
  • HY-P5430
    DYRKtide

    		DYRK Others
    DYRKtide is a biological active peptide. (Dyrktide is designed as the optimal substrate sequence efficiently phosphorylated by DYRK1A, which is a dual-specificity protein kinase that is thought to be involved in brain development.)
  • HY-P3460A
    TDSRCVIGLYHPPLQVY TFA
    1 Publications Verification

    		 Peptides Cardiovascular Disease Neurological Disease Inflammation/Immunology
    TDSRCVIGLYHPPLQVY TFA is a disordered control peptide. TDSRCVIGLYHPPLQVY TFA is a peptide containing the same amino acids as LP17 (HY-P3400) but in a different sequence order .
  • HY-P5394
    Dby HY Peptide (608-622), mouse

    		Peptides Others
    Dby HY Peptide (608-622), mouse is a biological active peptide. (Dby HY Peptide, NAGFNSNRANSSRSS, is a HYAb epitope belonging to a well-conserved family of genes coding for known or putative RNA helicases and containing a core sequence with a DEAD (Asp-Glu-Ala-Asp) box peptide motif, hence the name Dby (Dead box RNA helicase Y). The single Phenylalanine in the sequence serves as the anchor point while FNSNRANSS most likely is the “core” sequence of this HYAb epitope.)
  • HY-P0329
    X-press Tag Peptide

    		Peptides Others
    X-press Tag Peptide is a tag peptide used for protein purification. X-press Tag is also an N-terminal leader peptide; this N-terminal peptide contains a polyhistidine sequence, the Xpress epitope (part of bacteriophage T7 gene 10 protein) and an enterokinase cleavage site. Anti-Xpress antibodies recognize the Xpress epitope sequence found in this leader peptide.
  • HY-P3818
    PKCδ Peptide Substrate

    		PKC Others
    PKCδ Peptide Substrate is an absolutely specific substrate for the δ-type of PKC, with a sequence corresponding to sequence 422-443 of murine eEF-1α and containing Thr-431 .
  • HY-P10158
    PMAP-36

    Porcine cathelicidin PMAP-36

    		 Bacterial Infection
    PMAP-36 is an antimicrobial peptide, with sequence of GRFRRLRKKTRKRLKKIGKVLKWIPPIVGSIPLGCG. PMAP-36 with traditional antibiotics can enhance .
  • HY-P10471E
    MPSD control peptide TFA

    MARCKS-ED control peptide TFA

    		 MARCKS Others
    MPSD control peptide (MARCKS-ED control peptide) TFA is the control peptide of MPSD (HY-P10471). MPSD (MARCKS-ED) is a 25-amino acid peptide based on the effector domain sequence of the intracellular membrane protein myristoylated alanine-rich C-kinase substrate (MARCKS) .
  • HY-P4130
    MPS-Gαi2

    		Peptides Cancer
    MPS-Gαi2 is a peptide (membrane-permeable sequence). MPS-Gαi2 can be used for the research of cell adhesion .
  • HY-P2480
    Histone H1-derived Peptide

    		CDK Others
    Histone H1-derived Peptide is a phosphopeptide and the peptide substrates containes a sequence in accordance with the optimal recognition motif for CDK, can be used to detecting CDK1-cyclinB1 enzyme activity .
  • HY-P3526
    YQEAFRRFFGPV

    		Biochemical Assay Reagents Others
    YQEAFRRFFGPV is a short peptide sequence containing 12 amino acid residues with some emulsification ability
  • HY-P1517
    β-Amyloid (31-35)

    		Amyloid-β Neurological Disease
    β-Amyloid (31-35) is the shortest sequence of native Amyloid-β peptide that retains neurotoxic activity.
  • HY-P10638A
    TAT-CN21 (scrambled)

    		CaMK Cardiovascular Disease Neurological Disease
    TAT-CN21 (scrambled) is a nonsense sequence control peptide fused with the TAT cell-penetrating sequence. It exerts no inhibitory effect on CaMKII activity and serves as a negative control for TatCN21 (HY-P10638) .
  • HY-P5118A
    Tat-peptide 190-208 TFA

    		Peptides Neurological Disease
    Tat-peptide 190-208 TFA is a cell-permeable and Tat-labeled fusion peptide, corresponding to residues 190-208 of rat G3BP1. Tat sequence from HIV, is placed at the least conserved end of the sequence, for cell permeability. Tat-peptide 190-208 TFA increases axon growth and increases the number of neurites per neuron. Tat-peptide 190-208 TFA likely exhibits an axon intrinsic mechanism. Tat-peptide 190-208 TFA can be used for ischemic protection during endovascular repair for intracranial aneurysms .
  • HY-P4054
    IEIK 13

    		Peptides Others
    IEIK 13 is a self-assembling peptide (SAP) sequence. IEIK 13 can be used for the research of cartilage tissue engineering
  • HY-P11355A
    KRAS WT Peptide TFA

    		Amino Acid Derivatives Cancer
    KRAS WT Peptide TFA is the trifluoroacetate salt of KRAS WT Peptide (HY-P11355). KRAS WT Peptide is the normal sequence peptide of the Kirsten rat sarcoma virus (KRAS) gene without oncogenic mutations. KRAS WT Peptide can be used for the study of evaluating the specificity and safety of KRAS-targeted immunotherapies .
  • HY-P5433
    IRS1-derived peptide

    		Peptides Others
    IRS1-derived peptide is a biological active peptide. (This is a peptide fragment (979-989) of the insulin receptor substrate-1 containing the sequence motif YMXM known to bind to the two domains of SH2 on the 85kDa subunit of phosphoinositide 3-kinase.)
  • HY-P10610A
    Peptide 234CM TFA

    		MDM-2/p53 Cancer
    Peptide 234CM TFA is a peptide containing isoleucine at position 3, corresponding to the sequence of a point mutation in p53 codon 234. Peptide 234CM TFA induces potent cytotoxic T cell (CTL) and antitumor immune responses against mutant p53 .
  • HY-P2162
    Kemptamide

    		Myosin Cancer
    Kemptamide, a 13 amino acid fragment with a sequence corresponding to residues 11-23 of gizzard light chain. Kemptamide is a peptide substrate of myosin light-chain kinase (MLCK) .
  • HY-W101305
    Fmoc-Pen(Acm)-OH

    		Amino Acid Derivatives Others
    Fmoc-Pen(Acm)-OH is an amino acid derivative with an Fmoc protecting group that can be used to synthesize chemically modified cyclic peptides containing cell adhesion recognition (CAR) sequences .
  • HY-P1138
    Scrambled 10Panx

    FSVYWAQADR

    		 Gap Junction Protein Others
    Scrambled 10Panx (FSVYWAQADR) is a random sequence variant of a specific inhibitory peptide 10Panx targeted at the half-channel of Pannexin-1 (Panx1). Scrambled 10Panx is used as a control peptide to determine whether other experimental conditions or peptides act through specific molecular mechanisms. Scrambled 10Panx can be used for research in neurobiology and cell biology .
  • HY-P10593
    Influenza A NP (383-391) (HLA-B27)

    		Transmembrane Glycoprotein Influenza Virus Cancer
    Influenza A NP (383-391) (HLA-B27) is a peptide sequence derived from tetanus toxin. Influenza A NP (383-391) (HLA-B27) is a broadly immunogenic CD4+ T helper cell epitope that enhances CD8+ cytotoxic T lymphocyte (CTL) responses. Influenza A NP (383-391) (HLA-B27) can be used in breast cancer research .
  • HY-P4132
    Membrane-Permeable Sequence, MPS

    		Peptides Cancer
    Membrane-Permeable Sequence, MPS is a cell-penetrating peptide (CPP). Membrane-Permeable Sequence, MPS can be used for the research of membrane crossing mechanism .
  • HY-P10190
    CADY

    		Peptides Others
    CADY is a cell-penetrating peptide (CPPs) peptide with a sequence of GLWRALWRLLRSLWRLLWRA. CADY can be used as a vector tool for intracellular delivery .
  • HY-P2641
    Peptide 74

    		MMP Cancer
    Peptide 74 is a synthetic peptide containing the prodomain sequence of matrix metalloproteinase (MMP). Peptide 74 inhibits the activated form of the 72-kDa type IV collagenase in vitro .
  • HY-P11355
    KRAS WT Peptide

    		Peptides Cancer
    KRAS WT Peptide is the normal sequence peptide of the Kirsten rat sarcoma virus (KRAS) gene without oncogenic mutations. KRAS WT Peptide can be used for the study of evaluating the specificity and safety of KRAS-targeted immunotherapies .
  • HY-P1311
    RLLFT-NH2

    		Drug Isomer Others
    RLLFT-NH2 is a reversed amino acid sequence negative control peptide for TFLLR-NH2 .
  • HY-P10651
    Lifeact peptide

    		Biochemical Assay Reagents Others
    Lifeact peptide is a 17-amino-acid sequence derived from an actin-binding domain of yeasts. Lifeact peptide can specifically bind to actin microfilaments and can be used for the labeling of actin .
  • HY-P10610
    Peptide 234CM

    		MDM-2/p53 Cancer
    Peptide 234CM is a peptide containing isoleucine at position 3, corresponding to the sequence of a point mutation in p53 codon 234. Peptide 234CM induces potent cytotoxic T cell (CTL) and antitumor immune responses against mutant p53 .
  • HY-P3523
    KGDS

    		Integrin Others
    KGDS is synthetic peptides, targeting integrin GPIIb-IIIa located on the membrane of human activated platelets. Amino acid sequence: Lys-Gly-Asp-Ser .
  • HY-P4968
    Tau Peptide (337-368) (Repeat 4 Domain)

    		Tau Protein Others
    Tau Peptide (337-368) (Repeat 4 Domain) is a 32-amino acid peptide derived from the fourth microtubule-binding repeat sequence (R4) of the tau protein. Tau Peptide (337-368) (Repeat 4 Domain) can be used in research on neurodegenerative diseases .
  • HY-P11738
    Murine ZP3 peptide (330-342)

    		Peptides Endocrinology
    Murine ZP3 peptide (330-342) is a zona pellucida 3 polypeptide fragment with the amino acid sequence NSSSSQFQIHGPR. Murine ZP3 peptide (330-342) induces autoimmune premature ovarian failure (POF). Murine ZP3 peptide (330-342) can be used for the research of premature ovarian failure .
  • HY-P10422
    Multi-Leu peptide

    ML-peptide, Multi-Leucine (ML)-peptide

    		 Autophagy Cancer
    Multi-Leu peptide (ML-peptide) is a potent inhibitor of PACE4 (Ki=22 nM). Multi-Leu peptide can competitively bind to the active site of PACE4 by simulating the substrate sequence of PACE4, thereby inhibiting its catalytic activity. Multi-Leu peptide can be used to study the specific mechanism of PACE4 in the development of prostate cancer .
  • HY-P3287
    UL75 (14-42)，Human herpesvirus 5

    		Peptides Others
    UL75 (14-42), Human herpesvirus 5, as a peptide, is a sequence of human herpesvirus 5 .
  • HY-P3460
    TDSRCVIGLYHPPLQVY
    1 Publications Verification

    		 Peptides Cardiovascular Disease Neurological Disease Inflammation/Immunology
    TDSRCVIGLYHPPLQVY is a disordered control peptide. TDSRCVIGLYHPPLQVY is a peptide containing the same amino acids as LP17 (HY-P3400) but in a different sequence order .

Inquiry Online

Your information is safe with us. * Required Fields.

Salutation

  

Country or Region *

Applicant Name *

 

Organization Name *

Department *

     

Email Address *

 

Product Name *

Cat. No.

  

Requested quantity *

Phone Number *

     

Remarks

Inquiry Online

Inquiry Information

Product Name:
Cat. No.:
Quantity:
MCE Japan Authorized Agent: