PMAP-36
Based on 1 Customer Validation
PMAP-36 is an antimicrobial peptide, with sequence of GRFRRLRKKTRKRLKKIGKVLKWIPPIVGSIPLGCG. PMAP-36 with traditional antibiotics can enhance.
Nur für Forschungszwecke. Wir verkaufen nicht an Patienten.
- Reinheit: 95.79%
- CAS. Nr.: 154338-08-6
- Formel: C191H336N62O39S
- Molecular Weight:4157.17
-
Speicherung:
Sealed storage, away from moisture.
Powder -80°C, 2 years , -20°C, 1 year* In solvent : -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture)
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biologische Aktivität
-
Chemical Information
-
Lösungsmittel & Löslichkeit
- Reinheit & Dokumentation
- Verweise
-
Help & FAQs
Biologische Aktivität
Chemical Information
-
CAS. Nr. 154338-08-6
-
Appearance Solid
-
Molecular Weight 4157.17
-
Formel C191H336N62O39S
-
Color White to light yellow
-
Synonyms
Porcine cathelicidin PMAP-36
-
Sequence
Gly-Arg-Phe-Arg-Arg-Leu-Arg-Lys-Lys-Thr-Arg-Lys-Arg-Leu-Lys-Lys-Ile-Gly-Lys-Val-Leu-Lys-Trp-Ile-Pro-Pro-Ile-Val-Gly-Ser-Ile-Pro-Leu-Gly-Cys-Gly
-
Sequence Shortening
GRFRRLRKKTRKRLKKIGKVLKWIPPIVGSIPLGCG
-
Versand
Room temperature in continental US; may vary elsewhere.
-
Speicherung
Sealed storage, away from moisture
Powder -80°C 2 years -20°C 1 year * In solvent : -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture)
Lösungsmittel & Löslichkeit
DMSO : 25 mg/mL (6.01 mM; Need ultrasonic; Hygroscopic DMSO has a significant impact on the solubility of product, please use newly opened DMSO)
Please refer to the solubility information to select the appropriate solvent. Once prepared, please aliquot and store the solution to prevent product inactivation from repeated freeze-thaw cycles.
Storage method and period of stock solution: -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture). When stored at -80°C, please use it within 6 months. When stored at -20°C, please use it within 1 month.
Please refer to the solubility information to select the appropriate solvent. Once prepared, please aliquot and store the solution to prevent product inactivation from repeated freeze-thaw cycles.
Storage method and period of stock solution: -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture). When stored at -80°C, please use it within 6 months. When stored at -20°C, please use it within 1 month.
Konzentration (Stammlösung) × Volumen (Stammlösung) = Konzentration (Ziellösung) × Volumen (Ziellösung)
Reinheit & Dokumentation
-
Data Sheet (267 KB)
-
SDS (254 KB)
- English - EN (254 KB)
- Français - FR (254 KB)
- Deutsch - DE (254 KB)
- Norwegian - NO (254 KB)
- Español - ES (254 KB)
- Swedish - SV (254 KB)
- Italian - IT (254 KB)
- Korean - KR (254 KB)
- Portuguese - PT (254 KB)
-
Handling Instructions (2659 KB)
Verweise
Complete Stock Solution Preparation Table
Please refer to the solubility information to select the appropriate solvent. Once prepared, please aliquot and store the solution to prevent product inactivation from repeated freeze-thaw cycles.
Storage method and period of stock solution: -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture). When stored at -80°C, please use it within 6 months. When stored at -20°C, please use it within 1 month.
| Optional Solvent | Concentration Solvent Mass | 1 mg | 5 mg | 10 mg | 25 mg |
|---|---|---|---|---|---|
| DMSO | 1 mM | 0.2405 mL | 1.2027 mL | 2.4055 mL | 6.0137 mL |
| 5 mM | 0.0481 mL | 0.2405 mL | 0.4811 mL | 1.2027 mL |
PMAP-36 Related Classifications
HY-P10158 Related Classifications
Powered by Bioz