Tau Peptide (337-368) (Repeat 4 Domain)

Cat. No.: HY-P4968 Purity: 98.90%: Data Sheet
COA

SDS
Handling Instructions
FAQs
Technical Support

Tau Peptide (337-368) (Repeat 4 Domain) is a 32-amino acid peptide derived from the fourth microtubule-binding repeat sequence (R4) of the tau protein. Tau Peptide (337-368) (Repeat 4 Domain) can be used in research on neurodegenerative diseases.

For research use only. We do not sell to patients.

Tau Peptide (337-368) (Repeat 4 Domain) Chemical Structure

CAS No. : 330456-27-4

Size	Stock	Quantity
1 mg	In-stock	Estimated Time of Arrival: December 31
5 mg	In-stock	Estimated Time of Arrival: December 31
10 mg	In-stock	Estimated Time of Arrival: December 31
50 mg	Get quote
100 mg	Get quote

or Bulk Inquiry

* Please select Quantity before adding items.

This product is a controlled substance and not for sale in your territory.

Featured Recommendations

•Related Screening Libraries:

•Related Small Molecules:

•Related Proteins:

Biological Activity
Purity & Documentation
References
Customer Review

Description

In Vitro

Tau Peptide (337–368) (Repeat 4 Domain) is the core fragment of the fourth microtubule-binding repeat domain (R4) of the Tau 4R isoform. Located at the extreme C-terminus of the microtubule-binding region (MTBR; aa 244-368) and containing key sequences downstream of PHF6 (306-311; VQIVYK), it serves as a critical functional domain for Tau fibrillation and microtubule binding.

MedChemExpress (MCE) has not independently confirmed the accuracy of these methods. They are for reference only.

Molecular Weight

3467.84

Formula

C₁₅₀H₂₄₈N₄₄O₅₀

CAS No.

330456-27-4

Appearance

Solid

Color

White to off-white

Sequence

Val-Glu-Val-Lys-Ser-Glu-Lys-Leu-Asp-Phe-Lys-Asp-Arg-Val-Gln-Ser-Lys-Ile-Gly-Ser-Leu-Asp-Asn-Ile-Thr-His-Val-Pro-Gly-Gly-Gly-Asn

Sequence Shortening

VEVKSEKLDFKDRVQSKIGSLDNITHVPGGGN

Shipping

Room temperature in continental US; may vary elsewhere.

Storage

Sealed storage, away from moisture

Powder	-80°C	2 years
	-20°C	1 year

*In solvent : -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture)

Solvent & Solubility

In Vitro:

H₂O : ≥ 100 mg/mL (28.84 mM)

*"≥" means soluble, but saturation unknown.

Preparing
Stock Solutions

Concentration Solvent Mass	1 mg	5 mg	10 mg

1 mM	0.2884 mL	1.4418 mL	2.8836 mL
5 mM	0.0577 mL	0.2884 mL	0.5767 mL
10 mM	0.0288 mL	0.1442 mL	0.2884 mL

View the Complete Stock Solution Preparation Table

* Please refer to the solubility information to select the appropriate solvent. Once prepared, please aliquot and store the solution to prevent product inactivation from repeated freeze-thaw cycles.
Storage method and period of stock solution: -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture). When stored at -80°C, please use it within 6 months. When stored at -20°C, please use it within 1 month.

* Note: If you choose water as the stock solution, please dilute it to the working solution, then filter and sterilize it with a 0.22 μm filter before use.

Molarity Calculator
Dilution Calculator

Mass (g) = Concentration (mol/L) × Volume (L) × Molecular Weight (g/mol)

Concentration _(start) × Volume _(start) = Concentration _(final) × Volume _(final)

This equation is commonly abbreviated as: C₁V₁ = C₂V₂

Concentration _(start)

Volume _(start)

Concentration _(final)

Volume _(final)

In Vivo Dissolution Calculator

Please enter the basic information of animal experiments:

Dosage

mg/kg

Animal weight
(per animal)

Dosing volume
(per animal)

μL

Number of animals

Recommended: Prepare an additional quantity of animals to account for potential losses during experiments.

Calculation results:

Working solution concentration: mg/mL

This product has good water solubility, please refer to the measured solubility data in water/PBS/Saline for details.

The concentration of the stock solution you require exceeds the measured solubility. The following solution is for reference only.If necessary, please contact MedChemExpress (MCE).

Purity & Documentation

Purity: 98.90%

Select Batch:

Data Sheet (281 KB) SDS (254 KB)

COA (261 KB) RP-HPLC (113 KB) MS (214 KB)

Handling Instructions (2659 KB)

References

[1]. Birnbaum S, et al. Peptide screening. Current Opinion in Biotechnology, 1992, 3(1): 49-54.

Complete Stock Solution Preparation Table

Optional Solvent	Concentration Solvent Mass	1 mg	5 mg	10 mg	25 mg

H₂O	1 mM	0.2884 mL	1.4418 mL	2.8836 mL	7.2091 mL
	5 mM	0.0577 mL	0.2884 mL	0.5767 mL	1.4418 mL
	10 mM	0.0288 mL	0.1442 mL	0.2884 mL	0.7209 mL
	15 mM	0.0192 mL	0.0961 mL	0.1922 mL	0.4806 mL
	20 mM	0.0144 mL	0.0721 mL	0.1442 mL	0.3605 mL
	25 mM	0.0115 mL	0.0577 mL	0.1153 mL	0.2884 mL

* Note: If you choose water as the stock solution, please dilute it to the working solution, then filter and sterilize it with a 0.22 μm filter before use.