Tau Peptide (337-368) (Repeat 4 Domain)
Based on 1 Customer Validation
Tau Peptide (337-368) (Repeat 4 Domain) is a 32-amino acid peptide derived from the fourth microtubule-binding repeat sequence (R4) of the tau protein. Tau Peptide (337-368) (Repeat 4 Domain) can be used in research on neurodegenerative diseases.
For research use only. We do not sell to patients.
- Purity : 98.90%
- CAS No.: 330456-27-4
- Formula: C150H248N44O50
- Molecular Weight:3467.84
-
Storage:
Sealed storage, away from moisture.
Powder -80°C, 2 years , -20°C, 1 year* In solvent : -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture)
Biological Activity
Description
In Vitro
Tau Peptide (337–368) (Repeat 4 Domain) is the core fragment of the fourth microtubule-binding repeat domain (R4) of the Tau 4R isoform. Located at the extreme C-terminus of the microtubule-binding region (MTBR; aa 244-368) and containing key sequences downstream of PHF6 (306-311; VQIVYK), it serves as a critical functional domain for Tau fibrillation and microtubule binding.
MedChemExpress (MCE) has not independently confirmed the accuracy of these methods. They are for reference only.
Chemical Information
-
CAS No. 330456-27-4
-
Appearance Solid
-
Molecular Weight 3467.84
-
Formula C150H248N44O50
-
Color White to off-white
-
Sequence
Val-Glu-Val-Lys-Ser-Glu-Lys-Leu-Asp-Phe-Lys-Asp-Arg-Val-Gln-Ser-Lys-Ile-Gly-Ser-Leu-Asp-Asn-Ile-Thr-His-Val-Pro-Gly-Gly-Gly-Asn
-
Sequence Shortening
VEVKSEKLDFKDRVQSKIGSLDNITHVPGGGN
-
Shipping
Room temperature in continental US; may vary elsewhere.
-
Storage
Sealed storage, away from moisture
Powder -80°C 2 years -20°C 1 year * In solvent : -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture)
Solvent & Solubility
In Vitro:
H2O : ≥ 100 mg/mL (28.84 mM)
* "≥" means soluble, but saturation unknown.
Please refer to the solubility information to select the appropriate solvent. Once prepared, please aliquot and store the solution to prevent product inactivation from repeated freeze-thaw cycles.
Storage method and period of stock solution: -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture). When stored at -80°C, please use it within 6 months. When stored at -20°C, please use it within 1 month.
* Note: If you choose water as the stock solution, please dilute it to the working solution, then filter and sterilize it with a 0.22 μm filter before use.
Please refer to the solubility information to select the appropriate solvent. Once prepared, please aliquot and store the solution to prevent product inactivation from repeated freeze-thaw cycles.
Storage method and period of stock solution: -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture). When stored at -80°C, please use it within 6 months. When stored at -20°C, please use it within 1 month.
* Note: If you choose water as the stock solution, please dilute it to the working solution, then filter and sterilize it with a 0.22 μm filter before use.
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Purity & Documentation
-
Data Sheet (281 KB)
-
SDS (254 KB)
- English - EN (254 KB)
- Français - FR (254 KB)
- Deutsch - DE (254 KB)
- Norwegian - NO (254 KB)
- Español - ES (254 KB)
- Swedish - SV (254 KB)
- Italian - IT (254 KB)
- Korean - KR (254 KB)
- Portuguese - PT (254 KB)
-
Handling Instructions (2659 KB)
References
Complete Stock Solution Preparation Table
Please refer to the solubility information to select the appropriate solvent. Once prepared, please aliquot and store the solution to prevent product inactivation from repeated freeze-thaw cycles.
Storage method and period of stock solution: -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture). When stored at -80°C, please use it within 6 months. When stored at -20°C, please use it within 1 month.
| Optional Solvent | Concentration Solvent Mass | 1 mg | 5 mg | 10 mg | 25 mg |
|---|---|---|---|---|---|
| H2O | 1 mM | 0.2884 mL | 1.4418 mL | 2.8836 mL | 7.2091 mL |
| 5 mM | 0.0577 mL | 0.2884 mL | 0.5767 mL | 1.4418 mL | |
| 10 mM | 0.0288 mL | 0.1442 mL | 0.2884 mL | 0.7209 mL | |
| 15 mM | 0.0192 mL | 0.0961 mL | 0.1922 mL | 0.4806 mL | |
| 20 mM | 0.0144 mL | 0.0721 mL | 0.1442 mL | 0.3605 mL | |
| 25 mM | 0.0115 mL | 0.0577 mL | 0.1153 mL | 0.2884 mL |
* Note: If you choose water as the stock solution, please dilute it to the working solution, then filter and sterilize it with a 0.22 μm filter before use.