134875-67-5
Chemical Structure
Gastric Inhibitory Polypeptide (1-30), porcine
- CAS. Nr.: 134875-67-5
- Formula:C162H244N40O48S
- Molecular Weight:3551.97
SMILES: [YAEGTFISDYSIAMDKIRQQDFVNWLLAQK]
Biological Activity: Gastric Inhibitory Polypeptide (1-30), porcine lacks the C-terminal 12 amino acid residues of natural gastric inhibitory polypeptide (GIP), exhibits biologic activity by potentiating the release of insulin and somatostatin[1].
| Art. -Nr. | Produktname | Reinheit | Beschreibung | Pricing | |||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
|
|
Gastric Inhibitory Polypeptide (1-30), porcine | Gastric Inhibitory Polypeptide (1-30), porcine lacks the C-terminal 12 amino acid residues of natural gastric inhibitory polypeptide (GIP), exhibits biologic activity by potentiating the release of insulin and somatostatin. | |||||||||||||||||||||
|
loading...
/
|
|||||||||||||||||||||||