CD69 Protein, Human (HEK293, His)
Based on 1 Customer Validation
CD69 protein, a key player in lymphocyte proliferation, acts as a signaling receptor in lymphocytes, natural killer (NK) cells, and platelets. It forms homodimers connected by disulfide bonds, highlighting its central role in cellular signaling for immune responses and platelet function. CD69 Protein, Human (HEK293, His) is the recombinant human-derived CD69 protein, expressed by HEK293 , with N-8*His labeled tag.
- Species: Human
- Source: HEK293
-
Stockage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
-
Activité biologique
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Activité biologique
CD69 protein, a key player in lymphocyte proliferation, acts as a signaling receptor in lymphocytes, natural killer (NK) cells, and platelets. It forms homodimers connected by disulfide bonds, highlighting its central role in cellular signaling for immune responses and platelet function. CD69 Protein, Human (HEK293, His) is the recombinant human-derived CD69 protein, expressed by HEK293 , with N-8*His labeled tag.
The CD69 protein plays a pivotal role in lymphocyte proliferation, serving as a signal-transmitting receptor in lymphocytes, natural killer (NK) cells, and platelets. Structurally, it forms homodimers linked by disulfide bonds, emphasizing its involvement in cellular signaling processes crucial for immune responses and platelet function.
Technical Parameters
-
Species Human
-
Source HEK293
-
Tag N-8*His
-
Accession
Q07108 (G64-K199)
-
Molecular Construction
-
N-term
-
8*His
-
CD69 (G64-K199)
Accession # Q07108 -
C-term
-
-
Protein Length
Extracellular Domain
-
Synonyms
Early activation antigen CD69; AIM; MLR-3; CD69; CLEC2C
-
AA Sequence
GQYNCPGQYTFSMPSDSHVSSCSEDWVGYQRKCYFISTVKRSWTSAQNACSEHGATLAVIDSEKDMNFLKRYAGREEHWVGLKKEPGHPWKWSNGKEFNNWFNVTGSDKCVFLKNTEVSSMECEKNLYWICNKPYK
-
Predicted Molecular Mass
16.9 kDa
-
Masse moléculaire
Approximately 18-28 kDa, based on SDS-PAGE under reducing conditions.
-
Glycosylation
Yes
-
Pureté
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Fiche technique (235 KB)
-
SDS (251 KB)
- English - EN (251 KB)
- Français - FR (251 KB)
- Deutsch - DE (251 KB)
- Norwegian - NO (251 KB)
- Español - ES (251 KB)
- Swedish - SV (251 KB)
- Italian - IT (251 KB)
- Portuguese - PT (251 KB)
-
Instruction de manipulation (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
