Copy Link Print Information

Zika virus E/Envelope Protein (HEK293, His, Solution)

Genome polyprotein is a smaller protein chain of covalent linkages that is a key component of virus survival and replication.Zika virus E/Envelope Protein (HEK293, His) is the recombinant Virus-derived Zika virus E/Envelope protein, expressed by HEK293 , with C-His labeled tag.

Nur für Forschungszwecke. Wir verkaufen nicht an Patienten.
  • Species: Virus
  • Source: HEK293
  • Speicherung:
    Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
  • Zika virus E/Envelope Protein (HEK293, His, Solution) Product Image
  • Zika virus E/Envelope Protein (HEK293, His, Solution) Product Image
Größe
Preis
Verfügbarkeit
Menge
Amount: USD 0.00
Please select quantity
or
or

* Bitte wählen Sie Menge, bevor Sie Artikel hinzufügen.

To place orders, for customer services and technical support, please contact: MedChemExpress USA

Tel: 609-228-6898 E-mail: [email protected] [email protected]

Service
Data Download

To place orders, for customer services and technical support, please contact:

609-228-6898
[email protected] [email protected]
Finden Sie Ihren Händler vor Ort Your local distributor: Hycultec GmbHHycultec
  • Biologische Aktivität
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs
Top Publications Citing

Use of MCE Products

Biologische Aktivität

Beschreibung

Genome polyprotein is a smaller protein chain of covalent linkages that is a key component of virus survival and replication.Zika virus E/Envelope Protein (HEK293, His) is the recombinant Virus-derived Zika virus E/Envelope protein, expressed by HEK293 , with C-His labeled tag.

Background

Genome polyprotein is a series of protein units with similar or different functions that have been widely utilized by single-celled or multi-cellular organisms as concentrators of countless molecular activities. Genome polyprotein is a small protein chain that is covalently linked, and it is a common means of organizing the protein set of viruses (including HIV) in nature. As the signal peptide of NS4B, genome polyprotein is essential for the anti-interferon activity of NS4B. Genome polyprotein inhibits RNA silencing by interfering with host Dicer. Genome polyprotein may play a role in viral budding. Genome polyprotein exerts cytotoxic effects by activating the mitochondrial apoptosis pathway through the M ectodomain. Genome polyprotein may display viral protein activity[1][2].

Technical Parameters

  • Species Virus
  • Source HEK293
  • Tag C-His
  • Accession

    ALU33341.1 (V593-K699)

  • Gene ID
    /
  • Molecular Construction
    • N-term
    • Envelope (V593-K699)
      Accession # ALU33341.1
    • His
    • C-term
  • Protein Length

    Partial

  • Synonyms

    Zika virus (ZIKV) (strain Zika SPH2015) ZIKV-E/Envelope protein (Domain III, His)

  • AA Sequence

    VSYSLCTAAFTFTKIPAETLHGTVTVEVQYAGTDGPCKVPAQMAVDMQTLTPVGRLITANPVITESTENSKMMLELDPPFGDSYIVIGVGEKKITHHWHRSGSTIGK

  • Predicted Molecular Mass

    13 kDa

  • Reinheit

    ≥ 90%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Solution.

Formulation

Supplied as a 0.22 μm filtered solution of PBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

N/A.

Storage & Stability

Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Versand

Shipping with dry ice.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial)
=
Mass (in vial)
÷
Desired Reconstitution Concentration
Verdünnungsrechner

Konzentration (Stammlösung) × Volumen (Stammlösung) = Konzentration (Ziellösung) × Volumen (Ziellösung)

Konzentration (Stammlösung)
×
Volumen (Stammlösung)
=
Konzentration (Ziellösung)
×
Volumen (Ziellösung)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50)
106 ÷
ng/mL

Zika virus E/Envelope Protein (HEK293, His, Solution) Related Classifications

Measured by its ability to inhibit anti-CD3-induced proliferation of stimulated CTLL-2 mouse cytotoxic T cells. The ED50 this effect is 0.8023 μg/ml, corresponding to a specific activity is 1246.42 units/mg.

Assay Types
  • Zika virus E/Envelope Protein (HEK293, His, Solution) Product Image
    1/16
  • Zika virus E/Envelope Protein (HEK293, His, Solution) Product Image