IL-12R beta 1 Protein, Cynomolgus (Biotinylated, HEK293, His-Avi)
- Species: Cynomolgus
- Source: HEK293
-
Stockage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Technical Parameters
-
Species Cynomolgus
-
Source HEK293
-
Tag C-Avi;C-His
-
Accession
G7PWY9 (C24-D545)
-
Gene ID/
-
Molecular Construction
-
N-term
-
IL12RB1 (C24-D545)
Accession # G7PWY9 -
His-Avi
-
C-term
-
-
Protein Length
Extracellular Domain
-
Synonyms
Interleukin-12 receptor subunit beta-1; IL-12 receptor beta component
-
AA Sequence
CRTSECCFQDPPYSDADSGSASGPRDLSCYRISSAGYECSWQYEGPTAGVSHFLRCCLSSGRCCYFATGSATRLQFSDQAGVSVLHTVTLWVESWARNRTEKSPEVTLQLYKSVKYKPPLGDIKVSKLAGQLRMEWETPDNQVGAEVQFRHRTPSSSWKLGDCGPQDDDTESCLCPLEMNVAQEFQLRRRRLGSQGSSWSKWSSPVCVPPENPPQPQVRFSVEQLGRDGRRRLTLKEQPTQLELPEGCQGPAPGAEVTYQLQLHMLSCPCKAKATRTLPLEKMPYLSGAAYNVAVISSNRFGPGPNQTWHIPADTHTEPVALNISVGTNGTTMYWPARAQSATYCIEWQPVGQEGSLATCNLTAPQDPDPAGMATYSWSRESGAMGQEKCYHITIFASAHPKKLTLWSTVLSTYHFGGNASAAGTPHHVSVKNHSLDSVSVDWAPSLLSTCPGVLKEYVVRCRDEDSNQVSEHPVQPTETQVTLSDLRAGVAYTVQVRADTAWLRGAWSQPQRFSIKVQVSD
-
Predicted Molecular Mass
61 kDa
-
Masse moléculaire
Approximately 80-90 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.
-
Glycosylation
Yes
-
Pureté
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
Lyophilized from 0.22 μm filtered solution of PBS, pH7.4 with trehalose as protectant.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
