fimG Protein, E.coli (His)
fimG Protein, E.coli (His) is the recombinant E.coli-derived fimG protein, expressed by E. coli, with His tag.
- Species: E.coli
- Source: E. coli
-
Almacenamiento:Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Actividad biológica
fimG Protein, E.coli (His) is the recombinant E.coli-derived fimG protein, expressed by E. coli, with His tag.
fimG is involved in regulating the length of type 1 fimbriae and mediating their adhesion (though not essential for fimbriae production). It also facilitates the integration of FimH into the fimbrial structure.
Technical Parameters
-
Species E.coli
-
Source E. coli
-
Tag His
-
Accession
P08190 (A36-S167, Q157E)
-
Gene ID75203000
-
Protein Length
Partial
-
Synonyms
Protein FimG; fimG; Escherichia coli (strain K12)
-
AA Sequence
AKPCTVSTTNATVDLGDLYSFSLMSAGAASAWHDVALELTNCPVGTSRVTASFSGAADSTGYYKNQGTAQNIQLELQDDSGNTLNTGATKTVQVDDSSQSAHFPLQVRALTVNGGATQGTIEAVISITYTYS
-
Predicted Molecular Mass
29.8 kDa
-
Pureza
≥ 80%, as determined by reducing SDS-PAGE.
Product Properties
Solution.
Supplied as a 0.22 μm filtered solution of 50 mM HEPES (pH 7.5), 200mM NaCl, 20% glycerol, 1mM DTT.
<1 EU/μg, determined by LAL method.
Please use rapid thawing with running water to thaw the protein.
Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Shipping with dry ice.
Documentación
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)