country

Change Language

EN - English
FR - Français
DE - Deutsch
ES - Español
JA - 日本語
KO - 한국어

Product Name	Size / Unit Price	Qty

Total: USD 0.00 Checkout

Referencia número: HY-P11168

Copy Link Print Information

Diptericin

Diptericin is an antibacterial peptide, originally isolated from Phormia terranovae. Diptericin exhibits potent and selective activity against specific Gram-negative bacteria, such as Escherichia coli and Salmonella typhimurium. Diptericin kills bacteria within 1 hour. Diptericin can be used for antibacterial research.

Para uso exclusivo en investigación. No vendemos a pacientes.

Fòrmula: C₁₇₃H₂₆₈N₅₀O₅₅
Peso molecular:3928.28

Almacenamiento:

Please store the product under the recommended conditions in the Certificate of Analysis.

Diptericin Chemical Structure

Tamaño

Precio

Stock

Cantidad

Amount: USD 0.00

* Seleccione Cantidad antes de agregar artículos.

Top Publications Citing

Use of MCE Products

Fluorescent Dye

Strong Fluorescence Signal / Multi-Disciplinary Applications / High Fluorescence Specificity

Actividad biológica

Descripciòn

Chemical Information

Peso molecular 3928.28
Fòrmula C₁₇₃H₂₆₈N₅₀O₅₅
Sequence

Asp-Leu-His-Ile-Pro-Pro-Pro-Asp-Asn-Lys-Ile-Asn-Trp-Pro-Gln-Leu-Ser-Gly-Gly-Gly-Gly-Gly-Ser-Pro-Lys-Thr-Gly-Tyr-Asp-Ile-Asn-Ile-Asn-Ala-Gln-Gln-Lys
Sequence Shortening

DLHIPPPDNKINWPQLSGGGGGSPKTGYDININAQQK
Envío

Room temperature in continental US; may vary elsewhere.
Almacenamiento

Please store the product under the recommended conditions in the Certificate of Analysis.

Pureza y Documentación

Select Batch:

Pureza: 99.98%

Assay: 99.98%

ee.: 99.98%

Ficha de datos (257 KB)
COA (2659 KB)
Elemental Analysis Report (2659 KB)
HNMR (2659 KB)
CNMR (2659 KB)
RP-HPLC (2659 KB)
NP-HPLC (2659 KB)
MS (2659 KB)
LCMS (2659 KB)
IR (2659 KB)
GC (2659 KB)
OR (2659 KB)
SDS-PAGE (2659 KB)
SEC-HPLC (2659 KB)
Other Report (2659 KB)
Instrucciones de manejo (2659 KB)

Referencias

[1]. Cudic M, et al. Chemical synthesis, antibacterial activity and conformation of diptericin, an 82-mer peptide originally isolated from insects. Eur J Biochem. 1999 Dec;266(2):549-58. [Content Brief]

Calculators

Calculadora de molaridad

Mass (g) = Concentration (mol/L) × Volume (L) × Molecular Weight (g/mol)

Mass Mass

Concentration Concentration

Volume Volume

Molecular Weight Molecular Weight

Calculadora de dilución

Concentration _(start) × Volume _(start) = Concentration _(final) × Volume _(final)

Concentration _(start) Concentration _(start)

Volume _(start) Volume _(start)

Concentration _(final) Concentration _(final)

Volume _(final) Volume _(final)

Help & FAQs

How should lyophilized recombinant proteins be reconstituted and stored?

1. Before opening the cap, centrifuge the vial at 13000 rpm for 20-30 seconds. This step will ensure that any lyophilized powder that may have adhered to the cap or walls is collected at the bottom of the vial, minimizing the risk of product loss.

Keywords

100 mg

Obtener un presupuesto En stock