AHR Protein, Human (His)

AHR Protein, Human (His) is the recombinant human-derived AHR protein, expressed by E. coli, with N-10*His tag.

Para uso exclusivo en investigación. No vendemos a pacientes.
  • Species: Human
  • Source: E. coli
  • Almacenamiento:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Actividad biológica
  • Technical Parameters
  • Product Properties
  • Documentación
  • Help & FAQs

Actividad biológica

Descripciòn

AHR Protein, Human (His) is the recombinant human-derived AHR protein, expressed by E. coli, with N-10*His tag.

Background

The Aryl Hydrocarbon Receptor (AHR) is a ligand-activated transcription factor that enables cellular adaptation to environmental, dietary, microbial, and metabolic cues, playing critical roles in development, immunity, and cancer. Upon ligand binding, AHR translocates to the nucleus, heterodimerizes with ARNT, and induces gene expression by binding to xenobiotic response elements (XRE). It regulates diverse processes, including angiogenesis, hematopoiesis, drug/lipid metabolism, cell motility, and immune modulation. Xenobiotics (e.g., halogenated aromatic hydrocarbons) act as ligands, triggering phase I/II metabolizing enzyme gene expression (e.g., CYP1A1). Natural ligands from plants, microbiota, and endogenous metabolism (e.g., tryptophan derivatives) also potently activate AHR. Notably, AHR suppresses anti-tumor immunity—tryptophan catabolites (indoles, kynurenic acid) promote cancer cell motility and dampen adaptive immunity via AHR activation. Additionally, AHR inhibits the circadian gene PER1 by repressing CLOCK-BMAL1-mediated transcription. by similar: The AHR:ARNT heterodimer binds the core DNA sequence 5'-TGCGTG-3' within dioxin response elements (DRE) to activate target gene transcription.

Technical Parameters

  • Species Human
  • Source E. coli
  • Tag N-10*His
  • Accession
  • Gene ID
  • Molecular Construction
    • N-term
    • 10*His
    • AHR (F220-F420)
      Accession # P35869
    • C-term
  • Protein Length

    Partial

  • Synonyms

    Aryl hydrocarbon receptor; Ah receptor; lass E basic helix-loop-helix protein 76 (bHLHe76); AHR; BHLHE76

  • AA Sequence

    FICRLRCLLDNSSGFLAMNFQGKLKYLHGQKKKGKDGSILPPQLALFAIATPLQPPSILEIRTKNFIFRTKHKLDFTPIGCDAKGRIVLGYTEAELCTRGSGYQFIHAADMLYCAESHIRMIKTGESGMIVFRLLTKNNRWTWVQSNARLLYKNGRPDYIIVTQRPLTDEEGTEHLRKRNTKLPFMFTTGEAVLYEATNPF

  • Predicted Molecular Mass

    29 kDa

  • Peso molecular

    Approximately 30 kDa, based on SDS-PAGE under reducing conditions.

  • Structure/Form

    Monomer

  • Pureza

    ≥ 85%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of 20 mM HEPES, 150 mM NaCl, 6% trehalose, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Envío

Room temperature in continental US; may vary elsewhere.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial)
=
Mass (in vial)
÷
Desired Reconstitution Concentration
Calculadora de dilución

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start)
×
Volume (start)
=
Concentration (final)
×
Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50)
106 ÷
ng/mL