Aam-KTX
Aam-KTX is a Kv channel inhibitor with IC50 values of 1.1 nM and >750 nM for Kv1.3 and Kv1.1, respectively. Aam-KTX is a toxic peptide obtained from the venom of the scorpion Mesobuthus eupeus. Aam-KTX has potential in autoimmune diseases research.
For research use only. We do not sell to patients.
- Formula: C174H288N58O48S7
- Molecular Weight:4184.96
-
Storage:
Please store the product under the recommended conditions in the Certificate of Analysis.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Chemical Information
- Purity & Documentation
- References
-
Help & FAQs
Biological Activity
IC50: 1.1 nM (Kv1.3), ＞750 nM (Kv1.1)[1].
Chemical Information
-
Molecular Weight 4184.96
-
Formula C174H288N58O48S7
-
Sequence
Gly-Val-Glu-Ile-Asn-Val-Lys-Cys-Thr-Gly-Ser-His-Gln-Cys-Ile-Lys-Pro-Cys-Lys-Asp-Ala-Gly-Met-Arg-Phe-Gly-Lys-Cys-Ile-Asn-Arg-Lys-Cys-His-Cys-Thr-Pro-Lys-NH2 (Disulfide bridge:Cys8-Cys28;Cys14-Cys33;Cys18-Cys35)
-
Sequence Shortening
GVEINVKCTGSHQCIKPCKDAGMRFGKCINRKCHCTPK-NH2 (Disulfide bridge:Cys8-Cys28;Cys14-Cys33;Cys18-Cys35)
-
Shipping
Room temperature in continental US; may vary elsewhere.
-
Storage
Please store the product under the recommended conditions in the Certificate of Analysis.
Purity & Documentation
References
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Aam-KTX Related Classifications
HY-P5853 Related Classifications
Powered by Bioz