WFDC1/PS20 Protein, Mouse (His)
Based on 1 Customer Validation
WFDC1/PS20 protein inhibits growth. WFDC1/PS20 Protein, Mouse (His) is the recombinant mouse-derived WFDC1/PS20 protein, expressed by E. coli , with N-His labeled tag.
- Species: Mouse
- Source: E. coli
-
보관:Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Biological Activity
WFDC1/PS20 protein inhibits growth. WFDC1/PS20 Protein, Mouse (His) is the recombinant mouse-derived WFDC1/PS20 protein, expressed by E. coli , with N-His labeled tag.
WFDC1/PS20 protein exhibits growth inhibitory activity.
Technical Parameters
-
Species Mouse
-
Source E. coli
-
Tag N-8*His
-
Accession
Q9ESH5 (Q24-P211)
-
Molecular Construction
-
N-term
-
8*His
-
WFDC1 (Q24-P211)
Accession # Q9ESH5 -
C-term
-
-
Protein Length
Full Length of Mature Protein
-
Synonyms
Ps20; Wfdc1
-
AA Sequence
QGTWEAMLPARLAEKSRAEEVAATGSRQPHADRCPPPPRTLPPGACQATRCQADSECPRHRRCCYNGCAYACLEAVPPPPVLDWLVQPKPRWLGGNGWLLDGPEEVLQAETCSTTEDGAEPLLCPSGYECHILQPGDEAQGIPNHGQCVKQRRQAEGRVLRQRLHKEYPEGDSKNVAEPGKGQQRHFP
-
Predicted Molecular Mass
21.9 kDa
-
분자량
Approximately 27-30 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 95%, as determined by reducing SDS-PAGE or Bis-Tris PAGE.
-
≥ 95%, as determined by reducing SDS-PAGE.
-
Product Properties
Solution
Supplied as a 0.22 μm filtered solution of PBS, pH 7.4.
<1 EU/μg, determined by LAL method.
N/A.
Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Shipping with dry ice.
각종 서류
-
Data Sheet (233 KB)
-
SDS (251 KB)
- English - EN (251 KB)
- Français - FR (251 KB)
- Deutsch - DE (251 KB)
- Norwegian - NO (251 KB)
- Español - ES (251 KB)
- Swedish - SV (251 KB)
- Italian - IT (251 KB)
- Portuguese - PT (251 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)