ATP6AP2 Protein, Human (His-SUMO)
Based on 1 Customer Validation
The multifunctional ATP6AP2 protein serves as a cellular receptor for renin and prorenin, contributing to lysosomal V-ATPase assembly and endolysosomal acidification. It participates in renin-dependent reactions, activates ERK1/2, and may enhance the catalytic efficiency of renin in the renin-angiotensin system. ATP6AP2 Protein, Human (His-SUMO) is the recombinant human-derived ATP6AP2 protein, expressed by E. coli , with N-6*His, N-SUMO labeled tag.
- Species: Human
- Source: E. coli
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
The multifunctional ATP6AP2 protein serves as a cellular receptor for renin and prorenin, contributing to lysosomal V-ATPase assembly and endolysosomal acidification. It participates in renin-dependent reactions, activates ERK1/2, and may enhance the catalytic efficiency of renin in the renin-angiotensin system. ATP6AP2 Protein, Human (His-SUMO) is the recombinant human-derived ATP6AP2 protein, expressed by E. coli , with N-6*His, N-SUMO labeled tag.
The ATP6AP2 protein, a multifunctional player in cellular processes, serves as a renin and prorenin cellular receptor while contributing to the assembly of the lysosomal proton-transporting V-type ATPase (V-ATPase) and acidification of the endo-lysosomal system. It is implicated in renin-dependent cellular responses, activating ERK1 and ERK2, and plays a potential role in the renin-angiotensin system (RAS) by enhancing the catalytic efficiency of renin in AGT/angiotensinogen conversion to angiotensin I. Its involvement in V-ATPase assembly and lysosomal acidification regulates protein degradation, influencing signaling pathways crucial for proper brain development, synapse morphology, and synaptic transmission. ATP6AP2 interacts with renin and functions as an accessory component of the V-ATPase protein pump. Its interactions with ATP6AP1, ATP6V0D1, TMEM9, and VMA21 further underscore its intricate role in the assembly and regulation of the V-ATPase complex. This multifaceted functionality positions ATP6AP2 as a key orchestrator in various cellular pathways.
Technical Parameters
-
Species Human
-
Source E. coli
-
Tag N-6*His;N-SUMO
-
Accession
O75787 (N17-D350)
-
Molecular Construction
-
N-term
-
6*His-SUMO
-
ATP6AP2 (N17-D350)
Accession # O75787 -
C-term
-
-
Protein Length
Full Length of Mature Protein
-
Synonyms
APT6M8 9; APT6M8-9; ATP6AP2; ATP6IP2; ATP6M8-9; ATPase H+; -transporting lysosomal accessory protein 2;
-
AA Sequence
NEFSILKSPGSVVFRNGNWPIPGERIPDVAALSMGFSVKEDLSWPGLAVGNLFHRPRATVMVMVKGVNKLALPPGSVISYPLENAVPFSLDSVANSIHSLFSEETPVVLQLAPSEERVYMVGKANSVFEDLSVTLRQLRNRLFQENSVLSSLPLNSLSRNNEVDLLFLSELQVLHDISSLLSRHKHLAKDHSPDLYSLELAGLDEIGKRYGEDSEQFRDASKILVDALQKFADDMYSLYGGNAVVELVTVKSFDTSLIRKTRTILEAKQAKNPASPYNLAYKYNFEYSVVFNMVLWIMIALALAVIITSYNIWNMDPGYDSIIYRMTNQKIRMD
-
Predicted Molecular Mass
53.5 kDa
-
Purity
≥ 90%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
Lyophilized from a 0.22 μm filtered solution of 10 mM Tris-HCl, 1 mM EDTA, 6% trehalose, pH 8.0.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (237 KB)
-
SDS (251 KB)
- English - EN (251 KB)
- Français - FR (251 KB)
- Deutsch - DE (251 KB)
- Norwegian - NO (251 KB)
- Español - ES (251 KB)
- Swedish - SV (251 KB)
- Italian - IT (251 KB)
- Portuguese - PT (251 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
