CD99 Protein, Human (Biotinylated, HEK293, His-Avi)

The CD99 protein is involved in the important T cell adhesion process and helps red blood cells spontaneously form rosettes. It also contributes to the later stages of leukocyte extravasation, helping leukocytes to overcome the endothelial basement membrane during the immune response. CD99 Protein, Human (Biotinylated, HEK293, His-Avi) is the recombinant human-derived CD99 protein, expressed by HEK293 , with C-Avi, C-His labeled tag.

For research use only. We do not sell to patients.
  • Species: Human
  • Source: HEK293
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs

Biological Activity

Description

The CD99 protein is involved in the important T cell adhesion process and helps red blood cells spontaneously form rosettes. It also contributes to the later stages of leukocyte extravasation, helping leukocytes to overcome the endothelial basement membrane during the immune response. CD99 Protein, Human (Biotinylated, HEK293, His-Avi) is the recombinant human-derived CD99 protein, expressed by HEK293 , with C-Avi, C-His labeled tag.

Background

CD99 protein participates in crucial T-cell adhesion processes, contributing to spontaneous rosette formation with erythrocytes. Additionally, it plays a vital role in the late stages of leukocyte extravasation, aiding leukocytes in overcoming the endothelial basement membrane during immune responses. Remarkably, its function is independent of PECAM1, although it acts at the same site. The involvement of CD99 in T-cell adhesion processes underscores its significance in mediating cellular interactions essential for immune function.

Technical Parameters

  • Species Human
  • Source HEK293
  • Tag C-Avi;C-His
  • Accession
  • Gene ID
  • Protein Length

    Extracellular Domain

  • Conjugation

    Biotin

  • Synonyms

    CD99; MIC2 (Monoclonal Antibody 12E7); Prev. MIC2X; Cell Surface Antigen 12E7; Prev. MIC2Y; Cell Surface Antigen O13; Prev. MIC2; Surface Antigen MIC2; CD99 Antigen; CD99 Molecule; Antigen Identified By Monoclonal Antibodies 12E7, F21 And O13; Protein MIC

  • AA Sequence

    DGGFDLSDALPDNENKKPTAIPKKPSAGDDFDLGDAVVDGENDDPRPPNPPKPMPNPNPNHPSSSGSFSDADLADGVSGGEGKGGSDGGGSHRKEGEEAD

  • Predicted Molecular Mass

    13.7 kDa

  • Molecular Weight

    Approximately 22 kDa & 27 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

  • Purity

    ≥ 90%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00