Delta-like protein 3/DLL3 Protein, Human (P.pastoris, His)

Delta-like protein 3/DLL3 stands out as a key regulator of neurogenesis and cell differentiation. As an inhibitor of primary neurogenesis, DLL3 plays a crucial role in guiding neurons along specific differentiation pathways. Delta-like protein 3/DLL3 Protein, Human (P.pastoris, His) is the recombinant human-derived Delta-like protein 3/DLL3 protein, expressed by P. pastoris , with N-6*His labeled tag.

Delta-like protein 3/DLL3 emerges as a key regulator in the intricate landscape of neurogenesis and cellular differentiation. Acting as an inhibitor of primary neurogenesis, DLL3 is believed to play a crucial role in steering neurons along specific differentiation pathways. Its involvement extends beyond neurogenesis, contributing to the formation of somite boundaries during the segmentation of the paraxial mesoderm. Notably, DLL3 exhibits the capability to bind and activate Notch-1 or other Notch receptors, underscoring its significance in orchestrating cellular processes that govern developmental pathways and cellular fate determination.

Human

P. pastoris

N-6*His

Q9NYJ7-1 (A27-L492)

10683  [NCBI]

Extracellular Domain

AGVFELQIHSFGPGPGPGAPRSPCSARLPCRLFFRVCLKPGLSEEAAESPCALGAALSARGPVYTEQPGAPAPDLPLPDGLLQVPFRDAWPGTFSFIIETWREELGDQIGGPAWSLLARVAGRRRLAAGGPWARDIQRAGAWELRFSYRARCEPPAVGTACTRLCRPRSAPSRCGPGLRPCAPLEDECEAPLVCRAGCSPEHGFCEQPGECRCLEGWTGPLCTVPVSTSSCLSPRGPSSATTGCLVPGPGPCDGNPCANGGSCSETPRSFECTCPRGFYGLRCEVSGVTCADGPCFNGGLCVGGADPDSAYICHCPPGFQGSNCEKRVDRCSLQPCRNGGLCLDLGHALRCRCRAGFAGPRCEHDLDDCAGRACANGGTCVEGGGAHRCSCALGFGGRDCRERADPCAARPCAHGGRCYAHFSGLVCACAPGYMGARCEFPVHPDGASALPAAPPGLRPGDPQRYL

Approximately 56 kDa

≥ 90%, as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized from a 0.22 μm filtered solution of 20 mM Tris-HC1, 0.5 M NaCl, 6% trehalose, pH 8.0.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O.

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.