IL-22R alpha 1 Protein, Canine (HEK293, His)

IL-22R alpha 1 (IL22RA1) Protein is an IL-22 receptor. IL-22R alpha 1 Protein interacts with IL-22 to activate the JAK/STAT cascade thereby inhibits IL-22 mediated promotion of cell proliferation and anti-apoptosis. IL-22R alpha 1 Protein, Canine (HEK293, His) is expressed by HEK 293 cells and has a transmembrane region (M1-The226) with a His tag at the C-terminus^[1].

IL-22R alpha 1 (IL22RA1) Protein is a single-pass type I membrane protein. IL-22R alpha 1 expresses in colon, liver, lung, pancreas and kidney. IL-22R alpha 1 is primarily present on epithelial cells and certain monocyte subsets, and very limited IL-22R alpha 1 expression is found on other immune cells^[1][2].
The sequence of amino acids in IL-22R alpha 1 from different species is very different (less than 85% similarity among human, rat and Canine).
IL-22R alpha 1 is an essential component of the high-affinity IL-22 receptor enabling IL-22 signaling via JAK/STAT pathways. IL-22R alpha 1 is a component of one of the receptors for IL-20 and IL-24 formed and signaling through STATs activation. IL-22R alpha 1 mediates IL-24 antiangiogenic activity as well as IL24 inhibitory effect on endothelial cell tube formation and differentiation^[2][3].

Immobilized Human IL-22 at 5 μg/mL (100 μL/well) can bind Canine IL-22 R alpha 1. The ED₅₀ for this effect is 158.1 ng/mL.

• 
  Immobilized Human IL-22 at 5 μg/mL (100 μL/well) can bind Canine IL-22 R alpha 1. The ED₅₀ for this effect is 158.1 ng/mL

Canine

HEK293

C-His

XP_855113.2 (A15-T226)

612279  [NCBI]

Partial

AHIAEDTSDLLQYVKFQSSNFENILTWDSGLESAPDVVYSVEYKTYGKKEWLAKEGCQRITRKSCNLTTETGNHTEHYYARVTAVSAGGRSATKMTDRFSSMQQTTIKPPDVTCIPKVRSIQMIVHPTSTPIHAEDGHRLTLEDIFQDLFYRLELQVNHTYQMHLGGKQRDYEFIGLSPDTEFLGTITISVPNFFKESAPYVCRVKTLPDRT

Approximately 28-37 kDa

• 
  ≥ 95%, as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.

• [1]. Cui X, et, al. IL22 furthers malignant transformation of rat mesenchymal stem cells, possibly in association with IL22RA1/STAT3 signaling. Oncol Rep. 2019 Apr;41(4):2148-2158.  [Content Brief]

  [2]. Kragstrup TW, et, al. The IL-20 Cytokine Family in Rheumatoid Arthritis and Spondyloarthritis. Front Immunol. 2018 Sep 25;9:2226.  [Content Brief]

  [3]. Persaud L, et, al. Mechanism of Action and Applications of Interleukin 24 in Immunotherapy. Int J Mol Sci. 2016 Jun 2;17(6):869.  [Content Brief]