IL-22R alpha 1 Protein, Rat (HEK293, His)
Based on 1 Customer Validation
IL-22R alpha 1 (IL22RA1) Protein is an IL-22 receptor. IL-22R alpha 1 Protein interacts with IL-22 to activate the JAK/STAT cascade thereby inhibits IL-22 mediated promotion of cell proliferation and anti-apoptosis. IL-22R alpha 1 Protein, Rat (HEK293, His) is expressed by HEK 293 cells, with a His tag at the C-terminus.
- Species: Rat
- Source: HEK293
-
보관:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Biological Activity
IL-22R alpha 1 (IL22RA1) Protein is an IL-22 receptor. IL-22R alpha 1 Protein interacts with IL-22 to activate the JAK/STAT cascade thereby inhibits IL-22 mediated promotion of cell proliferation and anti-apoptosis. IL-22R alpha 1 Protein, Rat (HEK293, His) is expressed by HEK 293 cells, with a His tag at the C-terminus[1].
IL-22R alpha 1 (IL22RA1) Protein is a single-pass type I membrane protein. IL-22R alpha 1 expresses in colon, liver, lung, pancreas and kidney. IL-22R alpha 1 is primarily present on epithelial cells and certain monocyte subsets, and very limited IL-22R alpha 1 expression is found on other immune cells[1][2].
The sequence of amino acids in IL-22R alpha 1 from different species is very different (less than 85% similarity among human, rat and Canine).
IL-22R alpha 1 is an essential component of the high-affinity IL-22 receptor enabling IL-22 signaling via JAK/STAT pathways. IL-22R alpha 1 is a component of one of the receptors for IL-20 and IL-24 formed and signaling through STATs activation. IL-22R alpha 1 mediates IL-24 antiangiogenic activity as well as IL24 inhibitory effect on endothelial cell tube formation and differentiation[2][3].
Rat IL-22R alpha 1, His Tag immobilized on CM5 Chip can bind Biotinylated Mouse IL-22, His Tag with an affinity constant of 0.145 μM as determined in SPR assay (Biacore T200).
Technical Parameters
-
Species Rat
-
Source HEK293
-
Tag C-His
-
Accession
A0A8I6A0L8/NP_001178798.1 (H16-A228)
-
Molecular Construction
-
N-term
-
IL-22Rα 1 (H16-A228)
Accession # A0A8I6A0L8/NP_001178798.1 -
His
-
C-term
-
-
Protein Length
Partial
-
Synonyms
Interleukin-22 receptor subunit alpha-1; IL-22R-alpha-1; CRF2-9; ZcytoR11; IL22R
-
AA Sequence
HTTEDTSGLLRHVKFQSSNFENILTWDAGPASAPDTVYSVEYKKYGEKEWLAKAGCQRITQKFCNLTVETRNHTEFYYAKVTAVSSGGPPVTKMTDRFSSLQHTTIRPPDVTCIPKVRSIQMLVHPTLTPVLSEDGHQLTLEEIFHDLFYRLKLHVNHTYQMNLEGKQREYEFLGLTPDTEFLGSITILTPILSKESAPYTCRVKTLPDRTWA
-
분자량
Approximately 37-45 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.
-
Purity
≥ 95%, as determined by reducing SDS-PAGE or Bis-Tris PAGE.
-
≥ 95%, as determined by reducing SDS-PAGE.
-
Product Properties
Lyophilized powder.
Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
각종 서류
-
Data Sheet (263 KB)
-
SDS (251 KB)
- English - EN (251 KB)
- Français - FR (251 KB)
- Deutsch - DE (251 KB)
- Norwegian - NO (251 KB)
- Español - ES (251 KB)
- Swedish - SV (251 KB)
- Italian - IT (251 KB)
- Portuguese - PT (251 KB)
-
Handling Instructions (2659 KB)
References
[1]. Cui X, et, al. IL22 furthers malignant transformation of rat mesenchymal stem cells, possibly in association with IL22RA1/STAT3 signaling. Oncol Rep. 2019 Apr;41(4):2148-2158. [Content Brief]
[2]. Kragstrup TW, et, al. The IL-20 Cytokine Family in Rheumatoid Arthritis and Spondyloarthritis. Front Immunol. 2018 Sep 25;9:2226. [Content Brief]
[3]. Persaud L, et, al. Mechanism of Action and Applications of Interleukin 24 in Immunotherapy. Int J Mol Sci. 2016 Jun 2;17(6):869. [Content Brief]
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)