1. Recombinant Proteins
  2. Cytokines and Growth Factors Receptor Proteins
  3. Interleukin & Receptors Cytokine Receptors
  4. IL-22 Receptor
  5. IL-22R alpha 1
  6. IL-22R alpha 1 Protein, Rat (HEK293, His)

IL-22R alpha 1 Protein, Rat (HEK293, His)

Cat. No.: HY-P77002
COA Handling Instructions

IL-22R alpha 1 (IL22RA1) Protein is an IL-22 receptor. IL-22R alpha 1 Protein interacts with IL-22 to activate the JAK/STAT cascade thereby inhibits IL-22 mediated promotion of cell proliferation and anti-apoptosis. IL-22R alpha 1 Protein, Rat (HEK293, His) is expressed by HEK 293 cells and has a transmembrane region (M1-A228) with a His tag at the C-terminus.

For research use only. We do not sell to patients.

Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
2 μg $35 In-stock
5 μg $53 In-stock
10 μg $84 In-stock
50 μg $235 In-stock
100 μg $400 In-stock
500 μg $1120 In-stock
> 100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

  • References

Description

IL-22R alpha 1 (IL22RA1) Protein is an IL-22 receptor. IL-22R alpha 1 Protein interacts with IL-22 to activate the JAK/STAT cascade thereby inhibits IL-22 mediated promotion of cell proliferation and anti-apoptosis. IL-22R alpha 1 Protein, Rat (HEK293, His) is expressed by HEK 293 cells and has a transmembrane region (M1-A228) with a His tag at the C-terminus[1].

Background

IL-22R alpha 1 (IL22RA1) Protein is a single-pass type I membrane protein. IL-22R alpha 1 expresses in colon, liver, lung, pancreas and kidney. IL-22R alpha 1 is primarily present on epithelial cells and certain monocyte subsets, and very limited IL-22R alpha 1 expression is found on other immune cells[1][2].
The sequence of amino acids in IL-22R alpha 1 from different species is very different (less than 85% similarity among human, rat and Canine).
IL-22R alpha 1 is an essential component of the high-affinity IL-22 receptor enabling IL-22 signaling via JAK/STAT pathways. IL-22R alpha 1 is a component of one of the receptors for IL-20 and IL-24 formed and signaling through STATs activation. IL-22R alpha 1 mediates IL-24 antiangiogenic activity as well as IL24 inhibitory effect on endothelial cell tube formation and differentiation[2][3].

Biological Activity

Rat IL-22R alpha 1, His Tag immobilized on CM5 Chip can bind Biotinylated Mouse IL-22, His Tag with an affinity constant of 0.145 μM as determined in SPR assay (Biacore T200).

Species

Rat

Source

HEK293

Tag

C-His

Accession

D3ZIM3/NP_001178798.1 (H16-A228)

Gene ID

362629  [NCBI]

Molecular Construction
N-term
IL-22Rα 1 (H16-A228)
Accession # D3ZIM3/NP_001178798.1
His
C-term
Synonyms
Interleukin-22 receptor subunit alpha-1; IL-22R-alpha-1; CRF2-9; ZcytoR11; IL22R
AA Sequence

HTTEDTSGLLRHVKFQSSNFENILTWDAGPASAPDTVYSVEYKKYGEKEWLAKAGCQRITQKFCNLTVETRNHTEFYYAKVTAVSSGGPPVTKMTDRFSSLQHTTIRPPDVTCIPKVRSIQMLVHPTLTPVLSEDGHQLTLEEIFHDLFYRLKLHVNHTYQMNLEGKQREYEFLGLTPDTEFLGSITILTPILSKESAPYTCRVKTLPDRTWA

Molecular Weight

33-45 kDa.

Purity
  • Greater than 95% as determined by reducing SDS-PAGE.
Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation
References
Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
IL-22R alpha 1 Protein, Rat (HEK293, His)
Cat. No.:
HY-P77002
Quantity:
MCE Japan Authorized Agent: