2. Recombinant Proteins
  3. Cytokines and Growth Factors
  4. Peptide Hormone & Neuropeptides
  5. Irisin Protein, Human/Mouse/Rat (HEK293, Fc)

Irisin Protein, Human/Mouse/Rat (HEK293, Fc)

Cat. No.: HY-P70665
COA Handling Instructions

For research use only. We do not sell to patients.

Protein Expression Service

Size Price Stock Quantity
10 μg $150 In-stock
Estimated Time of Arrival: December 31
50 μg $450 In-stock
Estimated Time of Arrival: December 31
100 μg   Get quote  
250 μg   Get quote  
or Bulk Inquiry

* Please select Quantity before adding items.

Irisin Protein, Human/Mouse/Rat (HEK293, Fc) Featured Recommendations:

Top Publications Citing Use of Products

Publications Citing Use of MCE Irisin Protein, Human/Mouse/Rat (HEK293, Fc)

  • Technical Parameters

  • Properties

  • Documentation

Species

Human; Rat; Mouse
Source

HEK293
Tag

C-hFc
Accession

Q8NAU1 (D32-E143)
Gene ID

252995  [NCBI]
Synonyms
Fibronectin type III domain-containing protein 5; Fibronectin type III repeat-containing protein 2; Irisin; FNDC5
AA Sequence

DSPSAPVNVTVRHLKANSAVVSWDVLEDEVVIGFAISQQKKDVRMLRFIQEVNTTTRSCALWDLEEDTEYIVHVQAISIQGQSPASEPVLFKTPREAEKMASKNKDEVTMKE

Molecular Weight

50-60 kDa
Purity

Greater than 95% as determined by reducing SDS-PAGE.
Appearance

Lyophilized powder.
Formulation

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4.
Endotoxin Level

<1 EU/μg, determined by LAL method.
Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.
Storage & Stability

Stored at -20°C. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer. It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Shipping

Room temperature in continental US;may vary elsewhere.
Documentation

COA (232 KB)

Handling Instructions (2659 KB)

Irisin Protein, Human/Mouse/Rat (HEK293, Fc) Related Classifications

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Active Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific active calculator equation

Specific Active (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Active (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

  

Salutation

Applicant Name *

 

Email address *

Phone number *

 

Organization name *

Department *

 

Requested quantity *

Country or Region *

      

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Irisin Protein, Human/Mouse/Rat (HEK293, Fc)
Cat. No.:
HY-P70665
Quantity:
MCE Japan Authorized Agent:

Request for HNMR Report

Please fill out this form to request the QC report. We will send it to your Email address shortly.

Your information is safe with us. * Required Fields.

Product Name

  

Lot #

Applicant Name *

 

Country or Region *

Email address *

     

Phone number *

 

Organization name *

Remarks

Request for HNMR Report

We have received your request and will respond to you as soon as possible.