Irisin Protein, Human/Mouse/Rat (HEK293, Fc)

Measured by its ability to inhibit proliferation of A549 cells. The IC₅₀ for this effect is 0.651 ng/mL, corresponding to a specific activity is 1.5361×10⁶ units/mg.

• 
  Measured by its ability to inhibit proliferation of A549 cells. The IC₅₀ for this effect is 0.651 ng/mL, corresponding to a specific activity is 1.5361×10⁶ units/mg.

Human

HEK293

C-hFc

Q8NAU1 (D32-E143)

252995  [NCBI]

DSPSAPVNVTVRHLKANSAVVSWDVLEDEVVIGFAISQQKKDVRMLRFIQEVNTTTRSCALWDLEEDTEYIVHVQAISIQGQSPASEPVLFKTPREAEKMASKNKDEVTMKE

45-60 kDa

• 
  Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4 or 20 mM PB, 150 mM NaCl, pH 7.4.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.