LAIR1 Protein, Mouse (HEK293, Fc)
The LAIR1 protein functions as an inhibitory receptor that negatively regulates NK cells, B cells, and T cells. LAIR1 is activated by tyrosine phosphorylation, recruits PTPN6 and PTPN11, and exerts downstream inhibitory effects. LAIR1 Protein, Mouse (HEK293, Fc) is the recombinant mouse-derived LAIR1 protein, expressed by HEK293 , with C-hFc labeled tag.
- Species: Mouse
- Source: HEK293
-
보관:Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Biological Activity
The LAIR1 protein functions as an inhibitory receptor that negatively regulates NK cells, B cells, and T cells. LAIR1 is activated by tyrosine phosphorylation, recruits PTPN6 and PTPN11, and exerts downstream inhibitory effects. LAIR1 Protein, Mouse (HEK293, Fc) is the recombinant mouse-derived LAIR1 protein, expressed by HEK293 , with C-hFc labeled tag.
The LAIR1 protein operates as an inhibitory receptor, constitutively exerting a negative regulatory influence on the cytolytic function of natural killer (NK) cells, B-cells, and T-cells. Upon activation through tyrosine phosphorylation, LAIR1 recruits and activates phosphatases PTPN6 and PTPN11, leading to downstream inhibitory effects. Notably, it diminishes the increase in intracellular calcium triggered by B-cell receptor ligation. Beyond its role with SH2-containing phosphatases, LAIR1 independently modulates cytokine production in CD4+ T-cells, down-regulating IL2 and IFNG while inducing the secretion of transforming growth factor beta. It further regulates IgG and IgE production in B-cells, as well as the secretion of IL8, IL10, and TNF. LAIR1's impact extends to inhibiting proliferation, inducing apoptosis in myeloid leukemia cell lines, preventing nuclear translocation of NF-kappa-B p65 subunit/RELA, and inhibiting the phosphorylation of I-kappa-B alpha/CHUK in these cells. Moreover, it hinders the differentiation of peripheral blood precursors into dendritic cells. Interaction-wise, LAIR1 associates with the SH2 domains of tyrosine-protein phosphatases PTPN6 and PTPN11 constitutively and binds with high affinity to extracellular matrix collagens, a functionally significant interaction.
Technical Parameters
-
Species Mouse
-
Source HEK293
-
Tag C-hFc
-
Accession
Q8BG84-6 (Q22-S133)
-
Molecular Construction
-
N-term
-
LAIR1 (Q22-S133)
Accession # Q8BG84-6 -
hFc
-
C-term
-
-
Protein Length
Partial
-
Synonyms
Leukocyte-Associated Immunoglobulin-Like Receptor 1; LAIR-1; hLAIR1; CD305
-
AA Sequence
QEGSLPDITIFPNSSLMISQGTFVTVVCSYSDKHDLYNMVRLEKDGSTFMEKSTEPYKTEDEFEIGPVNETITGHYSCIYSKGITWSERSKTLELKVIKENVIQTPAPGPTS
-
Predicted Molecular Mass
39.6 kDa
-
분자량
Approximately 49-53 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.
-
Glycosylation
Yes
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Solution.
Supplied as a 0.2 μm filtered solution of PBS, pH 7.4.
<1 EU/μg, determined by LAL method.
N/A.
Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Shipping with dry ice.
각종 서류
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)