LAIR1 Protein, Mouse (HEK293, Fc)

The LAIR1 protein functions as an inhibitory receptor that negatively regulates NK cells, B cells, and T cells. LAIR1 is activated by tyrosine phosphorylation, recruits PTPN6 and PTPN11, and exerts downstream inhibitory effects. LAIR1 Protein, Mouse (HEK293, Fc) is the recombinant mouse-derived LAIR1 protein, expressed by HEK293 , with C-hFc labeled tag.

연구목적의 판매만을 진행합니다. 환자를 대상으로 한 판매는 하지 않습니다.
  • Species: Mouse
  • Source: HEK293
  • 보관:
    Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • 각종 서류
  • Help & FAQs

Biological Activity

제품 설명

The LAIR1 protein functions as an inhibitory receptor that negatively regulates NK cells, B cells, and T cells. LAIR1 is activated by tyrosine phosphorylation, recruits PTPN6 and PTPN11, and exerts downstream inhibitory effects. LAIR1 Protein, Mouse (HEK293, Fc) is the recombinant mouse-derived LAIR1 protein, expressed by HEK293 , with C-hFc labeled tag.

Background

The LAIR1 protein operates as an inhibitory receptor, constitutively exerting a negative regulatory influence on the cytolytic function of natural killer (NK) cells, B-cells, and T-cells. Upon activation through tyrosine phosphorylation, LAIR1 recruits and activates phosphatases PTPN6 and PTPN11, leading to downstream inhibitory effects. Notably, it diminishes the increase in intracellular calcium triggered by B-cell receptor ligation. Beyond its role with SH2-containing phosphatases, LAIR1 independently modulates cytokine production in CD4+ T-cells, down-regulating IL2 and IFNG while inducing the secretion of transforming growth factor beta. It further regulates IgG and IgE production in B-cells, as well as the secretion of IL8, IL10, and TNF. LAIR1's impact extends to inhibiting proliferation, inducing apoptosis in myeloid leukemia cell lines, preventing nuclear translocation of NF-kappa-B p65 subunit/RELA, and inhibiting the phosphorylation of I-kappa-B alpha/CHUK in these cells. Moreover, it hinders the differentiation of peripheral blood precursors into dendritic cells. Interaction-wise, LAIR1 associates with the SH2 domains of tyrosine-protein phosphatases PTPN6 and PTPN11 constitutively and binds with high affinity to extracellular matrix collagens, a functionally significant interaction.

Technical Parameters

  • Species Mouse
  • Source HEK293
  • Tag C-hFc
  • Accession
  • Gene ID
  • Molecular Construction
    • N-term
    • LAIR1 (Q22-S133)
      Accession # Q8BG84-6
    • hFc
    • C-term
  • Protein Length

    Partial

  • Synonyms

    Leukocyte-Associated Immunoglobulin-Like Receptor 1; LAIR-1; hLAIR1; CD305

  • AA Sequence

    QEGSLPDITIFPNSSLMISQGTFVTVVCSYSDKHDLYNMVRLEKDGSTFMEKSTEPYKTEDEFEIGPVNETITGHYSCIYSKGITWSERSKTLELKVIKENVIQTPAPGPTS

  • Predicted Molecular Mass

    39.6 kDa

  • 분자량

    Approximately 49-53 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

  • Glycosylation

    Yes

  • Purity

    ≥ 95%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Solution.

Formulation

Supplied as a 0.2 μm filtered solution of PBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

N/A.

Storage & Stability

Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

선적

Shipping with dry ice.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial)
=
Mass (in vial)
÷
Desired Reconstitution Concentration
농도 희석 계산기

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start)
×
Volume (start)
=
Concentration (final)
×
Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50)
106 ÷
ng/mL