WFDC1/PS20 Protein, Cynomolgus (His)
WFDC1/PS20 protein has growth inhibitory activity and regulates cell proliferation by hindering cell growth processes. Its actions suggest potential effects on various cellular processes in tissue development and homeostasis. WFDC1/PS20 Protein, Cynomolgus (His) is the recombinant cynomolgus-derived WFDC1/PS20 protein, expressed by E. coli , with N-His labeled tag.
- Species: Cynomolgus
- Source: E. coli
-
보관:Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
-
Biological Activity
-
Technical Parameters
-
Product Properties
- 각종 서류
- Help & FAQs
Biological Activity
WFDC1/PS20 protein has growth inhibitory activity and regulates cell proliferation by hindering cell growth processes. Its actions suggest potential effects on various cellular processes in tissue development and homeostasis. WFDC1/PS20 Protein, Cynomolgus (His) is the recombinant cynomolgus-derived WFDC1/PS20 protein, expressed by E. coli , with N-His labeled tag.
WFDC1/PS20 protein exhibits growth inhibitory activity, suggesting its role in regulating cellular proliferation. Through mechanisms not fully elucidated, WFDC1/PS20 appears to impede the progression of cell growth, potentially influencing various cellular processes involved in tissue development and homeostasis. The growth inhibitory function of WFDC1/PS20 underscores its significance in cellular regulatory networks, making it a candidate for further exploration in understanding the intricate control mechanisms governing cell proliferation.
Technical Parameters
-
Species Cynomolgus
-
Source E. coli
-
Tag N-8*His
-
Accession
XP_015298715.2 (K32-Q192)
-
Molecular Construction
-
N-term
-
8*His
-
WFDC1 (K32-Q192)
Accession # XP_015298715.2 -
C-term
-
-
Protein Length
Partial
-
Synonyms
Ps20; Wfdc1
-
AA Sequence
KNIWKRALPARLAEKSRTEEAGAPGGSRQPRADRCPPPPRTMPPGACQAVRCQADSECPRHRRCCYNGCAYACLEAVPPPPAEACSTTEDGAEPLLCPSGYECHILSPGDLAEGIPNRGQCVKQRRQADGRILRHKLYKEYPEGDSKNVAEPGRGQQRHFQ
-
Predicted Molecular Mass
18.8 kDa
-
분자량
Approximately 25-28 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Solution.
Supplied as a 0.22μm filtered solution of 20mM PB, 500mM NaCl, pH 7.4.
<1 EU/μg, determined by LAL method.
N/A.
Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Shipping with dry ice.
각종 서류
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
