1. Recombinant Proteins
  2. Enzymes & Regulators
  3. Protease Inhibitors
  4. Serpin (Protease Inhibitor)
  5. WFDC1/PS20 Protein, Cynomolgus (His)

WFDC1/PS20 protein has growth inhibitory activity and regulates cell proliferation by hindering cell growth processes. Its actions suggest potential effects on various cellular processes in tissue development and homeostasis. WFDC1/PS20 Protein, Cynomolgus (His) is the recombinant cynomolgus-derived WFDC1/PS20 protein, expressed by E. coli , with N-His labeled tag.

연구목적의 판매만을 진행합니다. 환자를 대상으로 한 판매는 하지 않습니다.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

사이즈 재고
50 μg   견적 받기  
100 μg   견적 받기  

* 장바구니에 담기 전 물품의 수량을 선택해 주십시오.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • 제품 설명

제품 설명

WFDC1/PS20 protein has growth inhibitory activity and regulates cell proliferation by hindering cell growth processes. Its actions suggest potential effects on various cellular processes in tissue development and homeostasis. WFDC1/PS20 Protein, Cynomolgus (His) is the recombinant cynomolgus-derived WFDC1/PS20 protein, expressed by E. coli , with N-His labeled tag.

Background

WFDC1/PS20 protein exhibits growth inhibitory activity, suggesting its role in regulating cellular proliferation. Through mechanisms not fully elucidated, WFDC1/PS20 appears to impede the progression of cell growth, potentially influencing various cellular processes involved in tissue development and homeostasis. The growth inhibitory function of WFDC1/PS20 underscores its significance in cellular regulatory networks, making it a candidate for further exploration in understanding the intricate control mechanisms governing cell proliferation.

Species

Cynomolgus

Source

E. coli

Tag

N-8*His

Accession

XP_015298715.2 (K32-Q192)

Gene ID
Molecular Construction
N-term
8*His
WFDC1 (K32-Q192)
Accession # XP_015298715.2
C-term
Protein Length

Partial

Synonyms
Ps20; Wfdc1
AA Sequence

KNIWKRALPARLAEKSRTEEAGAPGGSRQPRADRCPPPPRTMPPGACQAVRCQADSECPRHRRCCYNGCAYACLEAVPPPPAEACSTTEDGAEPLLCPSGYECHILSPGDLAEGIPNRGQCVKQRRQADGRILRHKLYKEYPEGDSKNVAEPGRGQQRHFQ

Predicted Molecular Mass
18.8 kDa
분자량

Approximately 25-28 kDa, based on SDS-PAGE under reducing conditions.

Purity

≥ 95%, as determined by reducing SDS-PAGE.

Endotoxin Level

<1 EU/μg, determined by LAL method.

각종 서류

WFDC1/PS20 Protein, Cynomolgus (His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

최근 본 상품:

온라인 문의

Your information is safe with us. * Required Fields.

WFDC1/PS20 Protein, Cynomolgus (His)

 

Requested Quantity *

고객명 *

 

호칭

메일주소 *

 

전화번호 *

Department

 

회사명 *

City

Country or Region *

     

비고

대량구매 문의

Inquiry Information

상품명:
WFDC1/PS20 Protein, Cynomolgus (His)
Cat. No.:
HY-P701034
수량:
MCE Japan Authorized Agent: