AADAT/alpha-Aminoadipate Aminotransferase Protein, Human (His-SUMO)

The α-aminoadipic acid aminotransferase protein exhibits broad substrate specificity, preferentially selecting aminoadipic acid, kynurenine, methionine, and glutamate as an aminotransferase. It also exhibits transaminase activity toward tryptophan, aspartate, and hydroxykynurenine, and accepts oxygen-containing acids such as 2-oxoglutarate, 2-oxohexanoic acid, phenylpyruvate, and α- Oxo-γ-methylmercaptanbutyric acid. AADAT/alpha-Aminoadipate Aminotransferase Protein, Human (His-SUMO) is the recombinant human-derived alpha-Aminoadipate Aminotransferase protein, expressed by E. coli , with N-6*His-SUMO tag.

For research use only. We do not sell to patients.
  • Species: Human
  • Source: E. coli
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs

Biological Activity

Description

The α-aminoadipic acid aminotransferase protein exhibits broad substrate specificity, preferentially selecting aminoadipic acid, kynurenine, methionine, and glutamate as an aminotransferase. It also exhibits transaminase activity toward tryptophan, aspartate, and hydroxykynurenine, and accepts oxygen-containing acids such as 2-oxoglutarate, 2-oxohexanoic acid, phenylpyruvate, and α- Oxo-γ-methylmercaptanbutyric acid. AADAT/alpha-Aminoadipate Aminotransferase Protein, Human (His-SUMO) is the recombinant human-derived alpha-Aminoadipate Aminotransferase protein, expressed by E. coli , with N-6*His-SUMO tag.

Background

The alpha-Aminoadipate Aminotransferase protein demonstrates broad substrate specificity, functioning as a transaminase with activity towards aminoadipate, kynurenine, methionine, and glutamate. This enzyme also exhibits transaminase activity towards tryptophan, aspartate, and hydroxykynurenine. Furthermore, it accepts various oxo-acids as amino-group acceptors, showing a preference for 2-oxoglutarate, 2-oxocaproic acid, phenylpyruvate, and alpha-oxo-gamma-methiol butyric acid. Notably, alpha-Aminoadipate Aminotransferase can utilize glyoxylate as an amino-group acceptor in vitro, showcasing its versatility in accepting diverse substrates in enzymatic reactions.

Technical Parameters

  • Species Human
  • Source E. coli
  • Tag N-SUMO;N-6*His
  • Accession
  • Gene ID
  • Molecular Construction
    • N-term
    • 6*His-SUMO
    • AadAT (P30-L425)
      Accession # Q8N5Z0-1
    • C-term
  • Protein Length

    Full Length of Mature Protein

  • Synonyms

    2-aminoadipate aminotransferase; 2-aminoadipate transaminase; AadAT; Glycine transaminase AADAT; Kynurenine aminotransferase II; Kynurenine--glyoxylate transaminase AADAT; Kynurenine--oxoglutarate aminotransferase II; Kynurenine--oxoglutarate transaminase

  • AA Sequence

    PKSMISLAGGLPNPNMFPFKTAVITVENGKTIQFGEEMMKRALQYSPSAGIPELLSWLKQLQIKLHNPPTIHYPPSQGQMDLCVTSGSQQGLCKVFEMIINPGDNVLLDEPAYSGTLQSLHPLGCNIINVASDESGIVPDSLRDILSRWKPEDAKNPQKNTPKFLYTVPNGNNPTGNSLTSERKKEIYELARKYDFLIIEDDPYYFLQFNKFRVPTFLSMDVDGRVIRADSFSKIISSGLRIGFLTGPKPLIERVILHIQVSTLHPSTFNQLMISQLLHEWGEEGFMAHVDRVIDFYSNQKDAILAAADKWLTGLAEWHVPAAGMFLWIKVKGINDVKELIEEKAVKMGVLMLPGNAFYVDSSAPSPYLRASFSSASPEQMDVAFQVLAQLIKESL

  • Predicted Molecular Mass

    60.2 kDa

  • Purity

    ≥ 90%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of Tris/PBS-based buffer, 6% Trehalose.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial)
=
Mass (in vial)
÷
Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start)
×
Volume (start)
=
Concentration (final)
×
Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50)
106 ÷
ng/mL