AADAT/alpha-Aminoadipate Aminotransferase Protein, Human (His-SUMO)
The α-aminoadipic acid aminotransferase protein exhibits broad substrate specificity, preferentially selecting aminoadipic acid, kynurenine, methionine, and glutamate as an aminotransferase. It also exhibits transaminase activity toward tryptophan, aspartate, and hydroxykynurenine, and accepts oxygen-containing acids such as 2-oxoglutarate, 2-oxohexanoic acid, phenylpyruvate, and α- Oxo-γ-methylmercaptanbutyric acid. AADAT/alpha-Aminoadipate Aminotransferase Protein, Human (His-SUMO) is the recombinant human-derived alpha-Aminoadipate Aminotransferase protein, expressed by E. coli , with N-6*His-SUMO tag.
- Species: Human
- Source: E. coli
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
The α-aminoadipic acid aminotransferase protein exhibits broad substrate specificity, preferentially selecting aminoadipic acid, kynurenine, methionine, and glutamate as an aminotransferase. It also exhibits transaminase activity toward tryptophan, aspartate, and hydroxykynurenine, and accepts oxygen-containing acids such as 2-oxoglutarate, 2-oxohexanoic acid, phenylpyruvate, and α- Oxo-γ-methylmercaptanbutyric acid. AADAT/alpha-Aminoadipate Aminotransferase Protein, Human (His-SUMO) is the recombinant human-derived alpha-Aminoadipate Aminotransferase protein, expressed by E. coli , with N-6*His-SUMO tag.
The alpha-Aminoadipate Aminotransferase protein demonstrates broad substrate specificity, functioning as a transaminase with activity towards aminoadipate, kynurenine, methionine, and glutamate. This enzyme also exhibits transaminase activity towards tryptophan, aspartate, and hydroxykynurenine. Furthermore, it accepts various oxo-acids as amino-group acceptors, showing a preference for 2-oxoglutarate, 2-oxocaproic acid, phenylpyruvate, and alpha-oxo-gamma-methiol butyric acid. Notably, alpha-Aminoadipate Aminotransferase can utilize glyoxylate as an amino-group acceptor in vitro, showcasing its versatility in accepting diverse substrates in enzymatic reactions.
Technical Parameters
-
Species Human
-
Source E. coli
-
Tag N-SUMO;N-6*His
-
Accession
Q8N5Z0-1 (P30-L425)
-
Molecular Construction
-
N-term
-
6*His-SUMO
-
AadAT (P30-L425)
Accession # Q8N5Z0-1 -
C-term
-
-
Protein Length
Full Length of Mature Protein
-
Synonyms
2-aminoadipate aminotransferase; 2-aminoadipate transaminase; AadAT; Glycine transaminase AADAT; Kynurenine aminotransferase II; Kynurenine--glyoxylate transaminase AADAT; Kynurenine--oxoglutarate aminotransferase II; Kynurenine--oxoglutarate transaminase
-
AA Sequence
PKSMISLAGGLPNPNMFPFKTAVITVENGKTIQFGEEMMKRALQYSPSAGIPELLSWLKQLQIKLHNPPTIHYPPSQGQMDLCVTSGSQQGLCKVFEMIINPGDNVLLDEPAYSGTLQSLHPLGCNIINVASDESGIVPDSLRDILSRWKPEDAKNPQKNTPKFLYTVPNGNNPTGNSLTSERKKEIYELARKYDFLIIEDDPYYFLQFNKFRVPTFLSMDVDGRVIRADSFSKIISSGLRIGFLTGPKPLIERVILHIQVSTLHPSTFNQLMISQLLHEWGEEGFMAHVDRVIDFYSNQKDAILAAADKWLTGLAEWHVPAAGMFLWIKVKGINDVKELIEEKAVKMGVLMLPGNAFYVDSSAPSPYLRASFSSASPEQMDVAFQVLAQLIKESL
-
Predicted Molecular Mass
60.2 kDa
-
Purity
≥ 90%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
Lyophilized from a 0.22 μm filtered solution of Tris/PBS-based buffer, 6% Trehalose.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
