Palicourein
Palicourein is a 37 amino acid cyclic polypeptide. Palicourein inhibits the in vitro cytopathic effects of HIV-1RF infection of CEM-SS cells with an EC50 value of 0.1 μM and an IC50 value of 1.5 μM.
Nur für Forschungszwecke. Wir verkaufen nicht an Patienten.
- CAS. Nr.: 331714-57-9
- Formel: C159H250N48O56S6
- Molecular Weight:3922.36
-
Speicherung:
Please store the product under the recommended conditions in the Certificate of Analysis.
Biologische Aktivität
|
Cell Line
|
Type | Value | Description | References |
|---|---|---|---|---|
| CEM-SS | EC50 |
0.1 μM
Compound: Palicourein
|
Antiviral activity against HIV1 RF infected in human CEM-SS cells assessed as inhibition of virus induced cytopathic effect by XTT assay
Antiviral activity against HIV1 RF infected in human CEM-SS cells assessed as inhibition of virus induced cytopathic effect by XTT assay
|
[PMID: 11430013] |
| CEM-SS | IC50 |
1.5 μM
Compound: Palicourein
|
Cytotoxicity against human CEM-SS cells by XTT assay
Cytotoxicity against human CEM-SS cells by XTT assay
|
[PMID: 11430013] |
Chemical Information
-
CAS. Nr. 331714-57-9
-
Molecular Weight 3922.36
-
Formel C159H250N48O56S6
-
Sequence
Cyclo(Gly-Asp-Pro-Thr-Phe-Cys-Gly-Glu-Thr-Cys-Arg-Val-Ile-Pro-Val-Cys-Thr-Tyr-Ser-Ala-Ala-Leu-Gly-Cys-Thr-Cys-Asp-Asp-Arg-Ser-Asp-Gly-Leu-Cys-Lys-Arg-Asn) (Disulfide bridge: Cys1-Cys4,Cys2-Cys5,Cys3-Cys6)
-
Sequence Shortening
Cyclo(GDPTFCGETCRVIPVCTYSAALGCTCDDRSDGLCKRN) (Disulfide bridge: Cys1-Cys4,Cys2-Cys5,Cys3-Cys6)
-
Versand
Room temperature in continental US; may vary elsewhere.
-
Speicherung
Please store the product under the recommended conditions in the Certificate of Analysis.
Reinheit & Dokumentation
Verweise
Calculators
Konzentration (Stammlösung) × Volumen (Stammlösung) = Konzentration (Ziellösung) × Volumen (Ziellösung)