LSM4 Protein, Human (His)
The LSM4 protein plays a crucial role in pre-mRNA splicing, participating in the U4/U6-U5 tri-snRNP complex during spliceosome assembly, and as a component of the precatalytic spliceosome (spliceosome B complex).In the heptameric LSM2-8 complex, LSM4 specifically binds to the 3' U region of U6 snRNA.LSM4 Protein, Human (His) is the recombinant human-derived LSM4 protein, expressed by E.coli , with N-6*His labeled tag.
- Species: Human
- Source: E. coli
-
Speicherung:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
-
Biologische Aktivität
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biologische Aktivität
The LSM4 protein plays a crucial role in pre-mRNA splicing, participating in the U4/U6-U5 tri-snRNP complex during spliceosome assembly, and as a component of the precatalytic spliceosome (spliceosome B complex).In the heptameric LSM2-8 complex, LSM4 specifically binds to the 3' U region of U6 snRNA.LSM4 Protein, Human (His) is the recombinant human-derived LSM4 protein, expressed by E.coli , with N-6*His labeled tag.
LSM4 protein plays a crucial role in pre-mRNA splicing, functioning as a key component of the U4/U6-U5 tri-snRNP complex involved in spliceosome assembly and the precatalytic spliceosome (spliceosome B complex). Alongside LSM2, LSM3, LSM5, LSM6, LSM7, and LSM8, LSM4 forms the heptameric LSM2-8 complex, which specifically binds to the 3'-terminal U-tract of U6 snRNA. This complex is an integral part of the U4/U6-U5 tri-snRNP complex, a fundamental building block in the intricate machinery orchestrating spliceosome assembly. The U4/U6-U5 tri-snRNP complex comprises various snRNAs and associated proteins, underscoring LSM4's essential contribution to the complex and highly regulated process of pre-mRNA splicing.
Technical Parameters
-
Species Human
-
Source E. coli
-
Tag N-6*His
-
Accession
Q9Y4Z0 (M1-Q139)
-
Molecular Construction
-
N-term
-
6*His
-
LSM4 (M1-Q139)
Accession # Q9Y4Z0 -
C-term
-
-
Protein Length
Full Length
-
Synonyms
U6 snRNA-Associated Sm-Like Protein LSm4; Glycine-Rich Protein; GRP; LSM4
-
AA Sequence
MLPLSLLKTAQNHPMLVELKNGETYNGHLVSCDNWMNINLREVICTSRDGDKFWRMPECYIRGSTIKYLRIPDEIIDMVKEEVVAKGRGRGGLQQQKQQKGRGMGGAGRGVFGGRGRGGIPGTGRGQPEKKPGRQAGKQ
-
Predicted Molecular Mass
17.5 kDa
-
Molecular Weight
Approximately 18 kDa, based on SDS-PAGE under reducing conditions.
-
Reinheit
≥ 90%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
Lyophilized from a 0.22 μm filtered solution of 20 mM Tris-HCl, 100 mM NaCl, 1 mM DTT, pH 8.0 .
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US;may vary elsewhere.
Documentation
Calculators
Konzentration (Stammlösung) × Volumen (Stammlösung) = Konzentration (Ziellösung) × Volumen (Ziellösung)
Powered by Bioz
