RANKL/TNFSF11 Protein, Human (HEK293)

4 Cited Publications
Kundenbewertung

Based on 4 publication(s) in Google Scholar

RANKL (TNFSF11), a type II transmembrane protein, is a receptor activator of NF-κB (RANK) ligand. RANKL is an activator of RANK. When binding to RANK, it induces the differentiation of monocyte/macrophage-lineage cells into osteoclasts and leads to osteoclast precursor maturation. RANKL is critical for osteoclasts maturation, bone modeling, and bone remodeling, as well as the development of lymph nodes (LNs). RANKL/TNFSF11 Protein, Human (HEK293) is a recombinant human RANKL (G64-D245) without any tag, which is produced in HEK293 cell.

Nur für Forschungszwecke. Wir verkaufen nicht an Patienten.
  • Species: Human
  • Source: HEK293
  • Speicherung:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Biologische Aktivität
  • Technical Parameters
  • Product Properties
  • Documentation
  • Verweise
  • Help & FAQs

Biologische Aktivität

Beschreibung

RANKL (TNFSF11), a type II transmembrane protein, is a receptor activator of NF-κB (RANK) ligand. RANKL is an activator of RANK. When binding to RANK, it induces the differentiation of monocyte/macrophage-lineage cells into osteoclasts and leads to osteoclast precursor maturation. RANKL is critical for osteoclasts maturation, bone modeling, and bone remodeling, as well as the development of lymph nodes (LNs). RANKL/TNFSF11 Protein, Human (HEK293) is a recombinant human RANKL (G64-D245) without any tag, which is produced in HEK293 cell[1][2].

Background

RANKL (TNFSF11) belongs to TNF family. RANKL is a type II transmembrane protein and is a receptor activator of NF-κB (RANK) ligand. RANKL is an activator of NF-κB. RANKL binds to NF-κB and induces the differentiation of monocyte/macrophage-lineage cells into osteoclasts and leads to osteoclast precursor maturation. In bone tissue, RANKL is expressed by osteoblasts, osteocytes and immune cells, especially in osteoblasts and osteocytes[1]. RANKL is also expressed by T cells and increases proliferation and survival of dendritic cells[2].
Human RANKL shares 82.02% and 84.44% common aa identity with mouse and rat respectively. Human RANKL consists of cytoplasmic domain (1-47), helical domain (48-68), and extracellular domain (69-317). The soluble chain (140-317) is released when cleaved by enzymes such as matrix metalloproteinases (MMP3 or 7) and ADAM[1][3].
RANKL is critical for osteoclasts maturation, bone modeling, and bone remodeling, as well as the development of lymph nodes (LNs)[1].

In Vitro

RANKL (human, -5 ng/mL, 24 h) stimulates migration of a clear cell RCC cell line, Caki-1[4].
RANKL (human, 24 h) stimulates PAa cell migration and invasion[5].

In Vivo

RANKL (human, .4 or 2 mg/kg/day, s.c.) induces high bone turnover and decreases bone volume, density, and strength in C57BL/6J female mice[6].

Verified Bioactivity

1.Immobilized human TNFSF11 at 2 μg/mL (100 μL/well) can bind human Osteoprotegerin-hFc and the EC50 is 5-40 ng/mL.
2. Measured by its ability to induce TRAP activity, inducing osteoclast differentiation of RAW 264.7 mouse monocyte/macrophage cells. The ED50 for this effect is < 20 ng/mL.
3. Loaded Narlumosbart (HY-P99966) on AHC2 biosensor, can bind RANKL/TNFSF11 Protein, Human (HEK293) with an affinity constant of <1.000E-11 M as determined in BLI assay.

Results
  • Experimental Validation Results for RANKL/TNFSF11 Protein, Human (HEK293)
    Measured by its ability to induce osteoclast differentiation of RAW 264.7 mouse monocyte/macrophage cells. The ED50 for this effect is 19.69 ng/mL, corresponding to a specific activity is 5.079×104 units/mg.
  • Experimental Validation Results for RANKL/TNFSF11 Protein, Human (HEK293)
    Loaded Narlumosbart (HY-P99966) on AHC2 biosensor, can bind RANKL/TNFSF11 Protein, Human (HEK293) with an affinity constant of <1.000E-11 M as determined in BLI assay.

Technical Parameters

  • Species Human
  • Source HEK293
  • Tag Tag Free
  • Accession
  • Gene ID
  • Molecular Construction
    • N-term
    • RANKL (G64-D245)
      Accession # AAC51762.1
    • C-term
  • Protein Length

    Partial

  • Synonyms

    Tumor necrosis factor ligand superfamily member 11; RANKL; CD254; ODF; OPGL; TNFSF11; TRANCE

  • AA Sequence

    GSQHIRAEKAMVDGSWLDLAKRSKLEAQPFAHLTINATDIPSGSHKVSLSSWYHDRGWGKISNMTFSNGKLIVNQDGFYYLYANICFRHHETSGDLATEYLQLMVYVTKTSIKIPSSHTLMKGGSTKYWSGNSEFHFYSINVGGFFKLRSGEEISIEVSNPSLLDPDQDATYFGAFKVRDID

  • Predicted Molecular Mass

    20.5 kDa

  • Molecular Weight

    Approximately 27-33 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

  • Glycosylation

    Yes

  • Reinheit

    ≥ 90%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder

Formulation

1.Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4, 5% trehalose, 5% mannitol, 0.01% Tween 80.
2.Lyophilized from a 0.22 μm filtered solution of 20 mM PB, 150 mM NaCl, pH 7.4.
Please refer to the lot-specific COA for specific buffer information.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Versand

Room temperature in continental US; may vary elsewhere.

Verweise

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial)
=
Mass (in vial)
÷
Desired Reconstitution Concentration
Verdünnungsrechner

Konzentration (Stammlösung) × Volumen (Stammlösung) = Konzentration (Ziellösung) × Volumen (Ziellösung)

Konzentration (Stammlösung)
×
Volumen (Stammlösung)
=
Konzentration (Ziellösung)
×
Volumen (Ziellösung)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50)
106 ÷
ng/mL