TNFSF3/Lymphotoxin Beta Protein, Cynomolgus (sf9, His)
Based on 1 Customer Validation
Lymphotoxin Beta (LT-beta) also known as TNFSF3, is a type II transmembrane glycoprotein of the TNF family. Lymphotoxin Beta binds to LTα to form membrane-anchored heterotrimers that activate canonical/noncanonical nuclear factor-κB (NF-κB) signaling thus inducing chemokine, cytokine or adhesion molecule expression, cell proliferation and cell survival. Lymphotoxin Beta also shows anti-inflammatory, anti-cancer activity. Lymphotoxin Beta regulates hepatic stellate cell function and wound healing in a murine model of chronic liver injury. TNFSF3/Lymphotoxin Beta Protein, Cynomolgus (sf9, His) is a recombinant protein with a N-Terminal His label, It consists of 197 amino acids (Q49-G244) and is produced in Sf9 insect cells.
- Species: Cynomolgus
- Source: Sf9 insect cells
-
Storage:Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Biological Activity
Lymphotoxin Beta (LT-beta) also known as TNFSF3, is a type II transmembrane glycoprotein of the TNF family. Lymphotoxin Beta binds to LTα to form membrane-anchored heterotrimers that activate canonical/noncanonical nuclear factor-κB (NF-κB) signaling thus inducing chemokine, cytokine or adhesion molecule expression, cell proliferation and cell survival. Lymphotoxin Beta also shows anti-inflammatory, anti-cancer activity[1]. Lymphotoxin Beta regulates hepatic stellate cell function and wound healing in a murine model of chronic liver injury[2]. TNFSF3/Lymphotoxin Beta Protein, Cynomolgus (sf9, His) is a recombinant protein with a N-Terminal His label, It consists of 197 amino acids (Q49-G244) and is produced in Sf9 insect cells.
LT is expressed by T, B, natural killer (NK)- and lymphoid tissue-inducer cells. While, Lymphotoxin Beta is expressed on inflammatory cells, LPCs, and occasional small hepatocytes adjacent to fibrous septa[1][2].
The amino acid sequence of human Lymphotoxin Beta protein has low homology to mouse Lymphotoxin Beta protein. While human Lymphotoxin Beta shares 96.72% aa sequence identity with Rhesus macaque Lymphotoxin Beta protein.
Lymphotoxin-β (LTβ) is exclusively anchored in the membrane as a type II transmembrane protein, binding LTα to form membrane-anchored heterotrimers (LTα1β2 and LTα2β1). LTα1β2 triggers LTβR, whereas LTα2β1 was reported to bind TNFR1 and TNFR2, LIGHT (TNFSF14) is an alternative ligand for the LTβR. Besides, LTαβ heterotrimers activate canonical/noncanonical nuclear factor-κB (NF-κB) signaling, a significant regulator of innate and adaptive immune responses, cell survival or apoptosis, cellular stress responses, development and maintenance of lymphoid organs[1].
Lymphotoxin-β (LTβ) is a proinflammatory cytokine of the tumor necrosis factor (TNF) family. Lymphotoxin-β activates NF-κB signaling and shows anti-inflammatory, anti-cancer activity[1]. Lymphotoxin-β increases the expression of IκBα mRNA and protein in hepatic stellate cells, and regulates hepatic stellate cell function and wound healing in a murine model of chronic liver injury[2]. Lymphotoxin-β promotes the mRNA expression of pro-inflammatory cytokines TNFα and IL-1β, enhances the mRNA expression of RelA, and may be a potential therapeutic target for bladder cancer[3].
Lymphotoxin-β (mouse) (-1 ng/mL; 12 h) increases the expression of IκBα mRNA, an NF-κB-responsive gene in a time and dose dependent manner, and increases the protein levels of IκBα in hepatic stellate cells (HSCs)[2].
Technical Parameters
-
Species Cynomolgus
-
Source Sf9 insect cells
-
Tag N-10*His
-
Accession
XP_005553605.2 (Q49-G244)
-
Gene ID102135554
-
Molecular Construction
-
N-term
-
10*His
-
TNFSF3 (Q49-G244)
Accession # XP_003897389.2 -
C-term
-
-
Protein Length
Partial
-
Synonyms
Lymphotoxin-beta; LT-beta; Tumor necrosis factor C; TNF-C; LTB; TNFSF3
-
AA Sequence
QDQGGLVTDTADPGAQAQQGLGFQKLPEEEPEADLSPGLPAAHLIGAPLKGQGLGWEATKEQAFLTSGTQFSDAEGLALPQDGLYYLYCLVGYRGRAPPGGAEPRGRSVTLRSSLYRAGGAYGPGTPELLLEGAETVTPVLDPAGRQGYGPLWYTSVGFGGLVQLRRGERVYVNISHPDMVDFARGKTFFGAVMVG
-
Predicted Molecular Mass
22.8 kDa
-
Molecular Weight
Approximately 25-35 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 90%, as determined by reducing SDS-PAGE.
Product Properties
Solution
Supplied as a 0.22 μm filtered solution of 20 mM Tris, 500 mM NaCl, pH 7.4.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.
<1 EU/μg, determined by LAL method.
N/A.
Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Shipping with dry ice.
Documentation
-
Data Sheet (265 KB)
-
SDS (252 KB)
- English - EN (252 KB)
- Français - FR (252 KB)
- Deutsch - DE (252 KB)
- Norwegian - NO (252 KB)
- Español - ES (252 KB)
- Swedish - SV (252 KB)
- Italian - IT (252 KB)
- Portuguese - PT (252 KB)
-
Handling Instructions (2659 KB)
References
[1]. Wolf MJ, et al. The unexpected role of lymphotoxin beta receptor signaling in carcinogenesis: from lymphoid tissue formation to liver and prostate cancer development. Oncogene. 2010 Sep 9;29(36):5006-18. [Content Brief]
[2]. Ruddell RG, et al. Lymphotoxin-beta receptor signaling regulates hepatic stellate cell function and wound healing in a murine model of chronic liver injury. Hepatology. 2009 Jan;49(1):227-39. [Content Brief]
[3]. Shen M, et al. Lymphotoxin β receptor activation promotes mRNA expression of RelA and pro-inflammatory cytokines TNFα and IL-1β in bladder cancer cells. Mol Med Rep. 2017 Jul;16(1):937-942. [Content Brief]
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)