CSRP1 Protein, Human (His)

Customer Review

Based on 1 Customer Validation

The CSRP1 protein is a protein that may be involved in neuronal development. It is known to interact with three other proteins: ASCC1, ASCC2 and TRIP4. CSRP1 Protein, Human (His) is the recombinant human-derived CSRP1 protein, expressed by E. coli , with C-His labeled tag.

For research use only. We do not sell to patients.
  • Species: Human
  • Source: E. coli
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs

Biological Activity

Description

The CSRP1 protein is a protein that may be involved in neuronal development. It is known to interact with three other proteins: ASCC1, ASCC2 and TRIP4. CSRP1 Protein, Human (His) is the recombinant human-derived CSRP1 protein, expressed by E. coli , with C-His labeled tag.

Background

CSRP1 Protein is a protein that shows potential involvement in the development of neurons. It is known to interact with three other proteins: ASCC1, ASCC2, and TRIP4. The precise function of CSRP1 Protein in neuronal development is not fully understood; however, its interaction with these proteins suggests its participation in various cellular processes and signaling pathways that contribute to the intricate process of neuronal development. Further research is needed to uncover the precise mechanisms by which CSRP1 Protein influences neuronal development and how its interactions with ASCC1, ASCC2, and TRIP4 contribute to this process.

Technical Parameters

  • Species Human
  • Source E. coli
  • Tag C-His
  • Accession
  • Gene ID
  • Molecular Construction
    • N-term
    • CSRP1 (M1-E193)
      Accession # P21291
    • His
    • C-term
  • Protein Length

    Full Length

  • Synonyms

    Cysteine and glycine-rich protein 1; CRP1; HEL-141; CSRP; CYRP

  • AA Sequence

    MPNWGGGKKCGVCQKTVYFAEEVQCEGNSFHKSCFLCMVCKKNLDSTTVAVHGEEIYCKSCYGKKYGPKGYGYGQGAGTLSTDKGESLGIKHEEAPGHRPTTNPNASKFAQKIGGSERCPRCSQAVYAAEKVIGAGKSWHKACFRCAKCGKGLESTTLADKDGEIYCKGCYAKNFGPKGFGFGQGAGALVHSE

  • Molecular Weight

    Approximately 23 kDa, based on SDS-PAGE under reducing conditions.

  • Purity

    ≥ 95%, as determined by reducing SDS-PAGE.

    • Experimental Validation Results for CSRP1 Protein, Human (His)
      ≥ 95%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial)
=
Mass (in vial)
÷
Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start)
×
Volume (start)
=
Concentration (final)
×
Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50)
106 ÷
ng/mL