GIP, rat TFA
Based on 1 Customer Validation
GIP, rat TFA is a bioactive peptide of rat origin. (GIP (glucose-dependent insulinotropic polypeptide or also known as gastric inhibitory polypeptide) is a 42-amino acid peptide released by K cells in the duodenum and jejunum in response to food intake. GIP and GLP (gastric-like peptide) are both intestinal A member of the insulinotropic hormone peptide family that stimulates insulin secretion from pancreatic beta cells and appears to also promote beta cell proliferation and beta cell survival. Recent studies suggest that GIP plays a role in lipid homeostasis and may play a role in the pathogenesis of obesity function in the mechanism.
연구목적의 판매만을 진행합니다. 환자를 대상으로 한 판매는 하지 않습니다.
- Purity: 99.81%
- 화학식: C226H343N61O66S.xC2HF3O2
- 분자량:5002.58 (free base)
-
보관:
Sealed storage, away from moisture and light, under nitrogen.
Powder -80°C, 2 years , -20°C, 1 year* In solvent : -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture and light, under nitrogen)
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Chemical Information
-
용액&용해도
- 순도&문서
-
Help & FAQs
Biological Activity
Chemical Information
-
Appearance Solid
-
분자량 5002.58 (free base)
-
화학식 C226H343N61O66S.xC2HF3O2
-
Color White to off-white
-
Sequence
Tyr-Ala-Glu-Gly-Thr-Phe-Ile-Ser-Asp-Tyr-Ser-Ile-Ala-Met-Asp-Lys-Ile-Arg-Gln-Gln-Asp-Phe-Val-Asn-Trp-Leu-Leu-Ala-Gln-Lys-Gly-Lys-Lys-Asn-Asp-Trp-Lys-His-Asn-Leu-Thr-Gln
-
Sequence Shortening
YAEGTFISDYSIAMDKIRQQDFVNWLLAQKGKKNDWKHNLTQ
-
선적
Room temperature in continental US; may vary elsewhere.
-
보관
Sealed storage, away from moisture and light, under nitrogen
Powder -80°C 2 years -20°C 1 year * In solvent : -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture and light, under nitrogen)
용액&용해도
DMSO : 100 mg/mL (Need ultrasonic; Hygroscopic DMSO has a significant impact on the solubility of product, please use newly opened DMSO)
순도&문서
-
Data Sheet (239 KB)
-
SDS (252 KB)
- English - EN (252 KB)
- Français - FR (252 KB)
- Deutsch - DE (252 KB)
- Norwegian - NO (252 KB)
- Español - ES (252 KB)
- Swedish - SV (252 KB)
- Italian - IT (252 KB)
- Korean - KR (252 KB)
- Portuguese - PT (252 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
GIP, rat TFA Related Classifications
HY-P5390A Related Classifications
Powered by Bioz