IL-20R beta Protein, Rat (HEK293, Fc)

IL-20R beta Protein (IL20RB) is the beta subunit of IL-20 receptor, forms functional heterodimers with different subunit protein and involves in STAT3 activation pathway^[1]. IL-20R beta Protein, Mouse (HEK293, His) is produced in HEK293 cells with a full length of 225 amino acids and a C-Terminal His-tag.

IL-20R beta (IL-12RB), also known as a beta subunit of IL-20 receptor (IL-20RB), belongs to the type II cytokine receptor family. IL-20R beta is widely expressed with highest levels in skin and testis and highly expressed in psoriatic skin^[1].
IL-20R beta forms functional heterodimers with different subunit protein. IL-20R beta serves as the receptor for IL-19, IL-20 and IL-24 by dimerizing with IL20RA, however serves as the receptor for IL-20 and IL-24 by dimerizing with IL-22RA1^[2].
IL-20RB/IL-20RA and IL-20RB/IL-22RA1, act function by binding IL-20, and then stimulates a signal transduction pathway through STAT3 in a keratinocyte cell line^[1].
However, the expression of both IL-20RB/IL-20RA is found to be upregulated in psoriatic skin lesions on keratinocytes^[3].
IL-20RB/IL-20RA and IL-20RB/IL-22RA1 bind to IL-24, induce rapid activation of Stat-1 and Stat-3 transcription factors, which appear to play a role in cell survival and proliferation^[4].

IL-2R beta/IL2RA is a receptor complex for IL-19. IL-2R beta is significantly up-regulated after IL-19 treatment (2 mg/kg; i.v. via tail wein; once daily for one week) in epidural fibrosis (EF) rats model^[5].
rIL-19 treatment improved hematoma clearance and attenuated neurological deficits induced by GMH, which was mediated through the upregulation of the IL-2R1/ERK/Nrf2 pathways^[6].

Rat

HEK293

C-hFc

B8K1X9 (F22-P227)

501043  [NCBI]

Partial

FLTDGATILPAPQNFSVRSTNMKHLLMWNPVTQPGETVFYFVQYQGEYESLYMSHIWIPSSQCSPTKGLECDVTDDVTATVPYNFRVMAMLGSQSSAWSNLEHPFNRNATVLTPPRMEVTEHGLHLVVELEDLGPQFEFLVVYWRMEPGAVERVKVVRSGDIPVHLETMDPGVMYCVKAQALVKTIGRHSAFSQPTCVEMQGESLP

Approximately 61 kDa,based on SDS-PAGE under reducing conditions.

≥ 80%, as determined by reducing SDS-PAGE.

<1 EU/μg, determined by LAL method.

• [1]. Blumberg H, et al. Interleukin 20: discovery, receptor identification, and role in epidermal function. Cell. 2001 Jan 12;10 4(1):9-19.  [Content Brief]

  [2]. Wegenka UM. IL-20: biological functions mediated through two types of receptor complexes. Cytokine Growth Factor Rev. 2010 Oct;21(5):353-63.  [Content Brief]

  [3]. Sheikh F, et al. Cutting edge: IL-26 signals through a novel receptor complex composed of IL-20 receptor 1 and IL-10 receptor 2. J Immunol. 2004 Feb 15;172(4):2006-10.  [Content Brief]

  [4]. Wang M, et al. Interleukin-24 and its receptors. Immunology. 2005 Feb;114(2):166-70.  [Content Brief]

  [5]. Wang QJ, et al. Exogenous IL-19 mediates downregulation of TGF-β through Erk and p38 pathway to inhibit epidural fibrosis. Eur Rev Med Pharmacol Sci. 2019 Sep;23(17):7184-7190.  [Content Brief]

  [6]. Liu S, et al. IL-20R Activation via rIL-19 Enhances Hematoma Resolution through the IL-20R1/ERK/Nrf2 Pathway in an Experimental GMH Rat Pup Model. Oxid Med Cell Longev. 2021 Jan 19;2021:5913424.