IL-20R beta Protein, Rat (HEK293, Fc)
IL-20R beta Protein (IL20RB) is the beta subunit of IL-20 receptor, forms functional heterodimers with different subunit protein and involves in STAT3 activation pathway. IL-20R beta Protein, Mouse (HEK293, His) is produced in HEK293 cells with a full length of 225 amino acids and a C-Terminal His-tag.
- Species: Rat
- Source: HEK293
-
Storage:Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- References
- Help & FAQs
Biological Activity
IL-20R beta Protein (IL20RB) is the beta subunit of IL-20 receptor, forms functional heterodimers with different subunit protein and involves in STAT3 activation pathway[1]. IL-20R beta Protein, Mouse (HEK293, His) is produced in HEK293 cells with a full length of 225 amino acids and a C-Terminal His-tag.
IL-20R beta (IL-12RB), also known as a beta subunit of IL-20 receptor (IL-20RB), belongs to the type II cytokine receptor family. IL-20R beta is widely expressed with highest levels in skin and testis and highly expressed in psoriatic skin[1].
IL-20R beta forms functional heterodimers with different subunit protein. IL-20R beta serves as the receptor for IL-19, IL-20 and IL-24 by dimerizing with IL20RA, however serves as the receptor for IL-20 and IL-24 by dimerizing with IL-22RA1[2].
IL-20RB/IL-20RA and IL-20RB/IL-22RA1, act function by binding IL-20, and then stimulates a signal transduction pathway through STAT3 in a keratinocyte cell line[1].
However, the expression of both IL-20RB/IL-20RA is found to be upregulated in psoriatic skin lesions on keratinocytes[3].
IL-20RB/IL-20RA and IL-20RB/IL-22RA1 bind to IL-24, induce rapid activation of Stat-1 and Stat-3 transcription factors, which appear to play a role in cell survival and proliferation[4].
IL-2R beta/IL2RA is a receptor complex for IL-19. IL-2R beta is significantly up-regulated after IL-19 treatment (2 mg/kg; i.v. via tail wein; once daily for one week) in epidural fibrosis (EF) rats model[5].
rIL-19 treatment improved hematoma clearance and attenuated neurological deficits induced by GMH, which was mediated through the upregulation of the IL-2R1/ERK/Nrf2 pathways[6].
Technical Parameters
-
Species Rat
-
Source HEK293
-
Tag C-hFc
-
Accession
B8K1X9 (F22-P227)
-
Molecular Construction
-
N-term
-
IL-2Rβ (F22-P227)
Accession # B8K1X9 -
hFc
-
C-term
-
-
Protein Length
Partial
-
Synonyms
Interleukin-20 receptor subunit beta; IL-20R-beta; IL-20RB; FNDC6; IL-20R2; DIRS1
-
AA Sequence
FLTDGATILPAPQNFSVRSTNMKHLLMWNPVTQPGETVFYFVQYQGEYESLYMSHIWIPSSQCSPTKGLECDVTDDVTATVPYNFRVMAMLGSQSSAWSNLEHPFNRNATVLTPPRMEVTEHGLHLVVELEDLGPQFEFLVVYWRMEPGAVERVKVVRSGDIPVHLETMDPGVMYCVKAQALVKTIGRHSAFSQPTCVEMQGESLP
-
Predicted Molecular Mass
50.2 kDa
-
Molecular Weight
Approximately 61 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 80%, as determined by reducing SDS-PAGE.
Product Properties
Solution.
Supplied as a 0.2 μm filtered solution of PBS, pH 7.4.
<1 EU/μg, determined by LAL method.
N/A.
Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Shipping with dry ice.
Documentation
References
[1]. Blumberg H, et al. Interleukin 20: discovery, receptor identification, and role in epidermal function. Cell. 2001 Jan 12;10 4(1):9-19. [Content Brief]
[2]. Wegenka UM. IL-20: biological functions mediated through two types of receptor complexes. Cytokine Growth Factor Rev. 2010 Oct;21(5):353-63. [Content Brief]
[3]. Sheikh F, et al. Cutting edge: IL-26 signals through a novel receptor complex composed of IL-20 receptor 1 and IL-10 receptor 2. J Immunol. 2004 Feb 15;172(4):2006-10. [Content Brief]
[4]. Wang M, et al. Interleukin-24 and its receptors. Immunology. 2005 Feb;114(2):166-70. [Content Brief]
[5]. Wang QJ, et al. Exogenous IL-19 mediates downregulation of TGF-β through Erk and p38 pathway to inhibit epidural fibrosis. Eur Rev Med Pharmacol Sci. 2019 Sep;23(17):7184-7190. [Content Brief]
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
