INHBE Protein, Human (HEK293, Fc)

고객리뷰

Based on 1 Customer Validation

The INHBE protein is an important molecular switch that coordinates the inhibin and activin systems to regulate pituitary follicle-stimulating hormone secretion. Its critical role extends to multiple physiological functions, including hormone secretion, cell development, insulin release, and bone growth. INHBE Protein, Human (HEK293, Fc) is the recombinant human-derived INHBE protein, expressed by HEK293 , with N-hFc labeled tag.

연구목적의 판매만을 진행합니다. 환자를 대상으로 한 판매는 하지 않습니다.
  • Species: Human
  • Source: HEK293
  • 보관:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • 각종 서류
  • Help & FAQs

Biological Activity

제품 설명

The INHBE protein is an important molecular switch that coordinates the inhibin and activin systems to regulate pituitary follicle-stimulating hormone secretion. Its critical role extends to multiple physiological functions, including hormone secretion, cell development, insulin release, and bone growth. INHBE Protein, Human (HEK293, Fc) is the recombinant human-derived INHBE protein, expressed by HEK293 , with N-hFc labeled tag.

Background

INHBE protein assumes a pivotal role in the intricate orchestration of the inhibin and activin systems, serving as a molecular switch to either inhibit or activate the secretion of follitropin by the pituitary gland. Within the broader context, inhibins and activins, and by extension, INHBE, contribute to the regulation of a myriad of physiological functions spanning hypothalamic and pituitary hormone secretion, gonadal hormone secretion, germ cell development and maturation, erythroid differentiation, insulin secretion, nerve cell survival, embryonic axial development, and bone growth. The dynamic interplay between inhibins and activins is underscored by their opposing functions, where inhibins, typified by heterodimeric structures like Inhibin A and Inhibin B, counteract the actions of activins. Structurally, INHBE exists in homodimeric or heterodimeric configurations through its association with alpha and beta subunits, intricately linked by one or more disulfide bonds. Notably, inhibins present as heterodimers comprising one alpha and one beta subunit, while activins, whether in homodimeric or heterodimeric form, exclusively consist of beta subunits, exemplifying the nuanced and versatile regulatory roles played by INHBE in shaping diverse physiological responses.

Technical Parameters

  • Species Human
  • Source HEK293
  • Tag N-hFc
  • Accession
  • Gene ID
  • Molecular Construction
    • N-term
    • hFc
    • INHBE (T237-S350)
      Accession # P58166
    • C-term
  • Protein Length

    Full Length of Mature Protein

  • Synonyms

    Inhibin beta E chain; Activin beta-E chain; INHBE

  • AA Sequence

    TPTCEPATPLCCRRDHYVDFQELGWRDWILQPEGYQLNYCSGQCPPHLAGSPGIAASFHSAVFSLLKANNPWPASTSCCVPTARRPLSLLYLDHNGNVVKTDVPDMVVEACGCS

  • Predicted Molecular Mass

    40.9 kDa

  • 분자량

    Approximately 43 kDa, based on SDS-PAGE under reducing conditions.

  • Purity

    ≥ 90%, as determined by reducing SDS-PAGE.

    • Experimental Validation Results for INHBE Protein, Human (HEK293, Fc)
      ≥ 90%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder

Formulation

1.Lyophilized from a 0.22 μm filtered solution of 20 mM PB, 150 mM NaCl, pH 7.4.
2.Lyophilized from a 0.22 μm filtered solution of PBS.
3.Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4, 8% trehalose.
Please refer to the lot-specific COA for specific buffer information.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

선적

Room temperature in continental US; may vary elsewhere.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial)
=
Mass (in vial)
÷
Desired Reconstitution Concentration
농도 희석 계산기

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start)
×
Volume (start)
=
Concentration (final)
×
Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50)
106 ÷
ng/mL