TNFSF3/Lymphotoxin Beta Protein, Cynomolgus (sf9, His)

Customer Review

Based on 1 Customer Validation

Lymphotoxin Beta (LT-beta) also known as TNFSF3, is a type II transmembrane glycoprotein of the TNF family. Lymphotoxin Beta binds to LTα to form membrane-anchored heterotrimers that activate canonical/noncanonical nuclear factor-κB (NF-κB) signaling thus inducing chemokine, cytokine or adhesion molecule expression, cell proliferation and cell survival. Lymphotoxin Beta also shows anti-inflammatory, anti-cancer activity. Lymphotoxin Beta regulates hepatic stellate cell function and wound healing in a murine model of chronic liver injury. TNFSF3/Lymphotoxin Beta Protein, Cynomolgus (sf9, His) is a recombinant protein with a N-Terminal His label, It consists of 197 amino acids (Q49-G244) and is produced in Sf9 insect cells.

For research use only. We do not sell to patients.
  • Species: Cynomolgus
  • Source: Sf9 insect cells
  • Storage:
    Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • References
  • Help & FAQs

Biological Activity

Description

Lymphotoxin Beta (LT-beta) also known as TNFSF3, is a type II transmembrane glycoprotein of the TNF family. Lymphotoxin Beta binds to LTα to form membrane-anchored heterotrimers that activate canonical/noncanonical nuclear factor-κB (NF-κB) signaling thus inducing chemokine, cytokine or adhesion molecule expression, cell proliferation and cell survival. Lymphotoxin Beta also shows anti-inflammatory, anti-cancer activity[1]. Lymphotoxin Beta regulates hepatic stellate cell function and wound healing in a murine model of chronic liver injury[2]. TNFSF3/Lymphotoxin Beta Protein, Cynomolgus (sf9, His) is a recombinant protein with a N-Terminal His label, It consists of 197 amino acids (Q49-G244) and is produced in Sf9 insect cells.

Background

LT is expressed by T, B, natural killer (NK)- and lymphoid tissue-inducer cells. While, Lymphotoxin Beta is expressed on inflammatory cells, LPCs, and occasional small hepatocytes adjacent to fibrous septa[1][2].
The amino acid sequence of human Lymphotoxin Beta protein has low homology to mouse Lymphotoxin Beta protein. While human Lymphotoxin Beta shares 96.72% aa sequence identity with Rhesus macaque Lymphotoxin Beta protein.
Lymphotoxin-β (LTβ) is exclusively anchored in the membrane as a type II transmembrane protein, binding LTα to form membrane-anchored heterotrimers (LTα1β2 and LTα2β1). LTα1β2 triggers LTβR, whereas LTα2β1 was reported to bind TNFR1 and TNFR2, LIGHT (TNFSF14) is an alternative ligand for the LTβR. Besides, LTαβ heterotrimers activate canonical/noncanonical nuclear factor-κB (NF-κB) signaling, a significant regulator of innate and adaptive immune responses, cell survival or apoptosis, cellular stress responses, development and maintenance of lymphoid organs[1].
Lymphotoxin-β (LTβ) is a proinflammatory cytokine of the tumor necrosis factor (TNF) family. Lymphotoxin-β activates NF-κB signaling and shows anti-inflammatory, anti-cancer activity[1]. Lymphotoxin-β increases the expression of IκBα mRNA and protein in hepatic stellate cells, and regulates hepatic stellate cell function and wound healing in a murine model of chronic liver injury[2]. Lymphotoxin-β promotes the mRNA expression of pro-inflammatory cytokines TNFα and IL-1β, enhances the mRNA expression of RelA, and may be a potential therapeutic target for bladder cancer[3].

In Vitro

Lymphotoxin-β (mouse) (-1 ng/mL; 12 h) increases the expression of IκBα mRNA, an NF-κB-responsive gene in a time and dose dependent manner, and increases the protein levels of IκBα in hepatic stellate cells (HSCs)[2].

Technical Parameters

  • Species Cynomolgus
  • Source Sf9 insect cells
  • Tag N-10*His
  • Accession
  • Gene ID
  • Molecular Construction
    • N-term
    • 10*His
    • TNFSF3 (Q49-G244)
      Accession # XP_003897389.2
    • C-term
  • Protein Length

    Partial

  • Synonyms

    LTB; P33; Prev. TNFC; LT-Beta; TNFSF3; TNF-C; Tumor Necrosis Factor Ligand Superfamily Member 3; Lymphotoxin Beta (TNF Superfamily, Member 3); Tumor Necrosis Factor C; Tumor Necrosis Factor Ligand 1C; Lymphotoxin-Beta; TNLG1C; Lymphotoxin Beta; TNF Superf

  • AA Sequence

    QDQGGLVTDTADPGAQAQQGLGFQKLPEEEPEADLSPGLPAAHLIGAPLKGQGLGWEATKEQAFLTSGTQFSDAEGLALPQDGLYYLYCLVGYRGRAPPGGAEPRGRSVTLRSSLYRAGGAYGPGTPELLLEGAETVTPVLDPAGRQGYGPLWYTSVGFGGLVQLRRGERVYVNISHPDMVDFARGKTFFGAVMVG

  • Predicted Molecular Mass

    22.8 kDa

  • Molecular Weight

    Approximately 25-35 kDa, based on SDS-PAGE under reducing conditions.

  • Purity

    ≥ 90%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Solution

Formulation

Supplied as a 0.22 μm filtered solution of 20 mM Tris, 500 mM NaCl, pH 7.4.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Storage & Stability

Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping

Shipping with dry ice.

References

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00