1. Recombinant Proteins
  2. Cytokines and Growth Factors
  3. TNF Superfamily
  4. TNF Superfamily Ligands
  5. Lymphotoxin-β
  6. TNFSF3/Lymphotoxin Beta Protein, Cynomolgus (sf9, His)

TNFSF3/Lymphotoxin Beta Protein, Cynomolgus (sf9, His)

Cat. No.: HY-P76482
Instrucciones de manejo Technical Support

Lymphotoxin Beta (LT-beta) also known as TNFSF3, is a type II transmembrane glycoprotein of the TNF family. Lymphotoxin Beta binds to LTα to form membrane-anchored heterotrimers that activate canonical/noncanonical nuclear factor-κB (NF-κB) signaling thus inducing chemokine, cytokine or adhesion molecule expression, cell proliferation and cell survival. Lymphotoxin Beta also shows anti-inflammatory, anti-cancer activity. Lymphotoxin Beta regulates hepatic stellate cell function and wound healing in a murine model of chronic liver injury. TNFSF3/Lymphotoxin Beta Protein, Cynomolgus (sf9, His) is a recombinant protein with a N-Terminal His label, It consists of 197 amino acids (Q49-G244) and is produced in Sf9 insect cells.

Para uso exclusivo en investigación. No vendemos a pacientes.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Tamaño Precio Stock Cantidad
10 μg En stock
50 μg Obtener un presupuesto
100 μg   Obtener un presupuesto  

* Seleccione Cantidad antes de agregar artículos.

Top Publications Citing Use of Products
  • Actividad biológica

  • Technical Parameters

  • Properties

  • Descripciòn

  • Referencias

Descripciòn

Lymphotoxin Beta (LT-beta) also known as TNFSF3, is a type II transmembrane glycoprotein of the TNF family. Lymphotoxin Beta binds to LTα to form membrane-anchored heterotrimers that activate canonical/noncanonical nuclear factor-κB (NF-κB) signaling thus inducing chemokine, cytokine or adhesion molecule expression, cell proliferation and cell survival. Lymphotoxin Beta also shows anti-inflammatory, anti-cancer activity[1]. Lymphotoxin Beta regulates hepatic stellate cell function and wound healing in a murine model of chronic liver injury[2]. TNFSF3/Lymphotoxin Beta Protein, Cynomolgus (sf9, His) is a recombinant protein with a N-Terminal His label, It consists of 197 amino acids (Q49-G244) and is produced in Sf9 insect cells.

Background

LT is expressed by T, B, natural killer (NK)- and lymphoid tissue-inducer cells. While, Lymphotoxin Beta is expressed on inflammatory cells, LPCs, and occasional small hepatocytes adjacent to fibrous septa[1][2].
The amino acid sequence of human Lymphotoxin Beta protein has low homology to mouse Lymphotoxin Beta protein. While human Lymphotoxin Beta shares 96.72% aa sequence identity with Rhesus macaque Lymphotoxin Beta protein.
Lymphotoxin-β (LTβ) is exclusively anchored in the membrane as a type II transmembrane protein, binding LTα to form membrane-anchored heterotrimers (LTα1β2 and LTα2β1). LTα1β2 triggers LTβR, whereas LTα2β1 was reported to bind TNFR1 and TNFR2, LIGHT (TNFSF14) is an alternative ligand for the LTβR. Besides, LTαβ heterotrimers activate canonical/noncanonical nuclear factor-κB (NF-κB) signaling, a significant regulator of innate and adaptive immune responses, cell survival or apoptosis, cellular stress responses, development and maintenance of lymphoid organs[1].
Lymphotoxin-β (LTβ) is a proinflammatory cytokine of the tumor necrosis factor (TNF) family. Lymphotoxin-β activates NF-κB signaling and shows anti-inflammatory, anti-cancer activity[1]. Lymphotoxin-β increases the expression of IκBα mRNA and protein in hepatic stellate cells, and regulates hepatic stellate cell function and wound healing in a murine model of chronic liver injury[2]. Lymphotoxin-β promotes the mRNA expression of pro-inflammatory cytokines TNFα and IL-1β, enhances the mRNA expression of RelA, and may be a potential therapeutic target for bladder cancer[3].

In Vitro

Lymphotoxin-β (mouse) (-1 ng/mL; 12 h) increases the expression of IκBα mRNA, an NF-κB-responsive gene in a time and dose dependent manner, and increases the protein levels of IκBα in hepatic stellate cells (HSCs)[2].

Species

Cynomolgus

Source

Sf9 insect cells

Tag

N-10*His

Accession

XP_005553605.2 (Q49-G244)

Gene ID

102135554

Molecular Construction
N-term
10*His
TNFSF3 (Q49-G244)
Accession # XP_003897389.2
C-term
Protein Length

Partial

Synonyms
Lymphotoxin-beta; LT-beta; Tumor necrosis factor C; TNF-C; LTB; TNFSF3
AA Sequence

QDQGGLVTDTADPGAQAQQGLGFQKLPEEEPEADLSPGLPAAHLIGAPLKGQGLGWEATKEQAFLTSGTQFSDAEGLALPQDGLYYLYCLVGYRGRAPPGGAEPRGRSVTLRSSLYRAGGAYGPGTPELLLEGAETVTPVLDPAGRQGYGPLWYTSVGFGGLVQLRRGERVYVNISHPDMVDFARGKTFFGAVMVG

Predicted Molecular Mass
22.8 kDa
Peso molecular

Approximately 25-35 kDa, based on SDS-PAGE under reducing conditions.

Pureza

≥ 90%, as determined by reducing SDS-PAGE.

Appearance

Solution

Formulation

Supplied as a 0.22 μm filtered solution of 20 mM Tris, 500 mM NaCl, pH 7.4.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

N/A.

Storage & Stability

Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Envío

Shipping with dry ice.

Documentación
Referencias

TNFSF3/Lymphotoxin Beta Protein, Cynomolgus (sf9, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Productos vistos recientemente:

Consulta en línea

Your information is safe with us. * Required Fields.

TNFSF3/Lymphotoxin Beta Protein, Cynomolgus (sf9, His)

 

Requested Quantity *

Nombre del solicitante *

 

Saludo

Direcciòn del E-mail *

 

Número de teléfono *

Department

 

Nombre de la Organizaciòn *

City

Provincia

Country or Region *

     

Observaciones

Consulta para venta a granel

Inquiry Information

Nombre del producto:
TNFSF3/Lymphotoxin Beta Protein, Cynomolgus (sf9, His)
Cat. No.:
HY-P76482
Cantidad:
MCE Japan Authorized Agent: