TSTA3 Protein, Human (His)
The TSTA3 protein plays a key role in catalyzing the two-step NADP-dependent conversion of GDP-4-dehydro-6-deoxy-D-mannose to GDP-fucose. The process involves successive epimerase and reductase reactions, ultimately leading to the biosynthesis of GDP-fucose. TSTA3 Protein, Human (His) is the recombinant human-derived TSTA3 protein, expressed by E. coli , with C-6*His labeled tag.
- Species: Human
- Source: E. coli
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
The TSTA3 protein plays a key role in catalyzing the two-step NADP-dependent conversion of GDP-4-dehydro-6-deoxy-D-mannose to GDP-fucose. The process involves successive epimerase and reductase reactions, ultimately leading to the biosynthesis of GDP-fucose. TSTA3 Protein, Human (His) is the recombinant human-derived TSTA3 protein, expressed by E. coli , with C-6*His labeled tag.
TSTA3, also known as GDP-L-fucose synthase, is an enzyme responsible for the two-step NADP-dependent conversion of GDP-4-dehydro-6-deoxy-D-mannose to GDP-fucose. This enzymatic process involves both an epimerase and a reductase reaction. In the first step, the epimerase activity facilitates the conversion of GDP-4-dehydro-6-deoxy-D-mannose to an intermediate, and in the subsequent reductase reaction, this intermediate is further reduced to yield GDP-fucose. GDP-fucose is a critical nucleotide sugar that serves as a precursor in the biosynthesis of fucosylated glycans. Fucosylation plays pivotal roles in various biological processes, including cell adhesion, immune response, and signaling. The catalytic function of TSTA3 in the synthesis of GDP-fucose highlights its importance in the regulation of glycan structures and their involvement in diverse cellular functions.
Technical Parameters
-
Species Human
-
Source E. coli
-
Tag C-6*His
-
Accession
Q13630 (M1-K321)
-
Molecular Construction
-
N-term
-
TSTA3 (M1-K321)
Accession # Q13630 -
6*His
-
C-term
-
-
Protein Length
Full Length
-
Synonyms
GFUS; Tissue Specific Transplantation Antigen P35B; Prev. TSTA3; Short-Chain Dehydrogenase/Reductase Family 4E Member 1; SDR4E1; GDP-4-Keto-6-Deoxy-D-Mannose Epimerase-Reductase; GDP-4-Keto-6-Deoxy-D-Mannose-3,5-Epimerase-4-Reductase; Testis Tissue Sperm-
-
AA Sequence
MGEPQGSMRILVTGGSGLVGKAIQKVVADGAGLPGEDWVFVSSKDADLTDTAQTRALFEKVQPTHVIHLAAMVGGLFRNIKYNLDFWRKNVHMNDNVLHSAFEVGARKVVSCLSTCIFPDKTTYPIDETMIHNGPPHNSNFGYSYAKRMIDVQNRAYFQQYGCTFTAVIPTNVFGPHDNFNIEDGHVLPGLIHKVHLAKSSGSALTVWGTGNPRRQFIYSLDLAQLFIWVLREYNEVEPIILSVGEEDEVSIKEAAEAVVEAMDFHGEVTFDTTKSDGQFKKTASNSKLRTYLPDFRFTPFKQAVKETCAWFTDNYEQARK
-
Predicted Molecular Mass
37 kDa
-
Molecular Weight
Approximately 40 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
