TSTA3 Protein, Human (His)
The TSTA3 protein plays a key role in catalyzing the two-step NADP-dependent conversion of GDP-4-dehydro-6-deoxy-D-mannose to GDP-fucose. The process involves successive epimerase and reductase reactions, ultimately leading to the biosynthesis of GDP-fucose. TSTA3 Protein, Human (His) is the recombinant human-derived TSTA3 protein, expressed by E. coli , with C-6*His labeled tag.
- Species: Human
- Source: E. coli
-
Almacenamiento:Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
-
Actividad biológica
-
Technical Parameters
-
Product Properties
- Documentación
- Help & FAQs
Actividad biológica
The TSTA3 protein plays a key role in catalyzing the two-step NADP-dependent conversion of GDP-4-dehydro-6-deoxy-D-mannose to GDP-fucose. The process involves successive epimerase and reductase reactions, ultimately leading to the biosynthesis of GDP-fucose. TSTA3 Protein, Human (His) is the recombinant human-derived TSTA3 protein, expressed by E. coli , with C-6*His labeled tag.
TSTA3, also known as GDP-L-fucose synthase, is an enzyme responsible for the two-step NADP-dependent conversion of GDP-4-dehydro-6-deoxy-D-mannose to GDP-fucose. This enzymatic process involves both an epimerase and a reductase reaction. In the first step, the epimerase activity facilitates the conversion of GDP-4-dehydro-6-deoxy-D-mannose to an intermediate, and in the subsequent reductase reaction, this intermediate is further reduced to yield GDP-fucose. GDP-fucose is a critical nucleotide sugar that serves as a precursor in the biosynthesis of fucosylated glycans. Fucosylation plays pivotal roles in various biological processes, including cell adhesion, immune response, and signaling. The catalytic function of TSTA3 in the synthesis of GDP-fucose highlights its importance in the regulation of glycan structures and their involvement in diverse cellular functions.
The enzyme activity of this recombinant protein is testing in progress, we cannot offer a guarantee yet.
Technical Parameters
-
Species Human
-
Source E. coli
-
Tag C-6*His
-
Accession
Q13630 (M1-K321)
-
Molecular Construction
-
N-term
-
TSTA3 (M1-K321)
Accession # Q13630 -
6*His
-
C-term
-
-
Protein Length
Full Length
-
Synonyms
GDP-L-Fucose Synthase; GDP-4-Keto-6-Deoxy-D-Mannose-3; 5-Epimerase-4-Reductase; Protein FX; Red Cell NADP(H)-Binding Protein; Short-Chain Dehydrogenase/Reductase Family 4E Member 1; TSTA3; SDR4E1
-
AA Sequence
MGEPQGSMRILVTGGSGLVGKAIQKVVADGAGLPGEDWVFVSSKDADLTDTAQTRALFEKVQPTHVIHLAAMVGGLFRNIKYNLDFWRKNVHMNDNVLHSAFEVGARKVVSCLSTCIFPDKTTYPIDETMIHNGPPHNSNFGYSYAKRMIDVQNRAYFQQYGCTFTAVIPTNVFGPHDNFNIEDGHVLPGLIHKVHLAKSSGSALTVWGTGNPRRQFIYSLDLAQLFIWVLREYNEVEPIILSVGEEDEVSIKEAAEAVVEAMDFHGEVTFDTTKSDGQFKKTASNSKLRTYLPDFRFTPFKQAVKETCAWFTDNYEQARK
-
Predicted Molecular Mass
37 kDa
-
Peso molecular
Approximately 40 kDa, based on SDS-PAGE under reducing conditions.
-
Pureza
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Solution.
Supplied as a 0.22 μm filtered solution of 20 mM Tris, 150 mM NaCl, pH 8.0.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.
<1 EU/μg, determined by LAL method.
N/A
Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Shipping with dry ice.
Documentación
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
