NNC0165-1273 TFA
NNC0165-1273 (TFA) is the trifluoroacetic acid of NNC0165-1273 (HY-P11291). NNC0165-1273 is an analog of gut hormone peptide YY (PYY3-36). NNC0165-1273 has a superior affinity for Y2 receptor over Y1, Y4, and Y5 receptor. NNC0165-1273 has a potent anorectic effect and significantly reduces nighttime and ghrelin-induced food intake by producing early satiety. NNC0165-1273 inhibits ghrelin-induced cFos expression in NPY/AgRP neurons. NNC0165-1273 can be used for antiobesity therapies research.
Nur für Forschungszwecke. Wir verkaufen nicht an Patienten.
- Formel: C186H280N54O54·xC2HF3O2
- Molecular Weight:4136.54 (free base)
-
Speicherung:
Sealed storage, away from moisture.
Powder -80°C, 2 years , -20°C, 1 year* In solvent : -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture)
Alle Neuropeptide Y Receptor Isoform-spezifische Produkte anzeigen
More
Biologische Aktivität
Chemical Information
-
Appearance Solid
-
Molecular Weight 4136.54 (free base)
-
Formel C186H280N54O54·xC2HF3O2
-
Sequence
Ile-Lys-Pro-Glu-Ala-Pro-Gly-Glu-Asp-Ala-Ser-Pro-Glu-Glu-Leu-Asn-Arg-Tyr-Tyr-Ala-Ser-Leu-Arg-His-Tyr-Leu-Asn-Trp-Val-Thr-Arg-Gln-{β-homoArg}-Tyr-NH2
-
Sequence Shortening
IKPEAPGEDASPEELNRYYASLRHYLNWVTRQ-{β-homoArg}-Y-NH2
-
Versand
Room temperature in continental US; may vary elsewhere.
-
Speicherung
Sealed storage, away from moisture
Powder -80°C 2 years -20°C 1 year * In solvent : -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture)
Reinheit & Dokumentation
-
Data Sheet (282 KB)
-
SDS (252 KB)
- English - EN (252 KB)
- Français - FR (252 KB)
- Deutsch - DE (252 KB)
- Norwegian - NO (252 KB)
- Español - ES (252 KB)
- Swedish - SV (252 KB)
- Italian - IT (252 KB)
- Korean - KR (252 KB)
- Portuguese - PT (252 KB)
-
Handling Instructions (2659 KB)
Verweise
Calculators
Konzentration (Stammlösung) × Volumen (Stammlösung) = Konzentration (Ziellösung) × Volumen (Ziellösung)