pTH (1-37) (human)
Based on 1 Customer Validation
PTH (1-37) human is an adenylate cyclase stimulator and a normocalcemic regulator. PTH (1-37) human participates in cAMP-dependent signal transduction to affect the proliferation of skeletal tissue cells and bone metabolism. PTH (1-37) human induces cyclic adenosine monophosphate responses in human primary osteoblast-like cells and is also widely used in osteoporosis-related research.
Nur für Forschungszwecke. Wir verkaufen nicht an Patienten.
- Reinheit: 99.91%
- CAS. Nr.: 136799-54-7
- Formel: C195H316N58O54S2
- Molecular Weight:4401.08
-
Speicherung:
Sealed storage, away from moisture.
Powder -80°C, 2 years , -20°C, 1 year* In solvent : -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture)
Biologische Aktivität
pTH (1-37) (human) maintains a consistent secondary and tertiary structure in near physiological aqueous buffer solution that matches the structures of hPTH(1-34) and hPTH(1-39) under identical conditions[1].
pTH (1-37) (human) contains approximately 27% α-helical structure in near physiological aqueous buffer solution, matching the helix content of hPTH(1-34) and hPTH(1-39) under identical conditions[1].
MedChemExpress (MCE) has not independently confirmed the accuracy of these methods. They are for reference only.
Chemical Information
-
CAS. Nr. 136799-54-7
-
Appearance Solid
-
Molecular Weight 4401.08
-
Formel C195H316N58O54S2
-
Color White to off-white
-
Sequence
Ser-Val-Ser-Glu-Ile-Gln-Leu-Met-His-Asn-Leu-Gly-Lys-His-Leu-Asn-Ser-Met-Glu-Arg-Val-Glu-Trp-Leu-Arg-Lys-Lys-Leu-Gln-Asp-Val-His-Asn-Phe-Val-Ala-Leu
-
Sequence Shortening
SVSEIQLMHNLGKHLNSMERVEWLRKKLQDVHNFVAL
-
Versand
Room temperature in continental US; may vary elsewhere.
-
Speicherung
Sealed storage, away from moisture
Powder -80°C 2 years -20°C 1 year * In solvent : -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture)
Lösungsmittel & Löslichkeit
DMSO : ≥ 100 mg/mL (22.72 mM; Hygroscopic DMSO has a significant impact on the solubility of product, please use newly opened DMSO)
H2O : ≥ 50 mg/mL (11.36 mM)
* "≥" means soluble, but saturation unknown.
Please refer to the solubility information to select the appropriate solvent. Once prepared, please aliquot and store the solution to prevent product inactivation from repeated freeze-thaw cycles.
Storage method and period of stock solution: -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture). When stored at -80°C, please use it within 6 months. When stored at -20°C, please use it within 1 month.
* Note: If you choose water as the stock solution, please dilute it to the working solution, then filter and sterilize it with a 0.22 μm filter before use.
Please refer to the solubility information to select the appropriate solvent. Once prepared, please aliquot and store the solution to prevent product inactivation from repeated freeze-thaw cycles.
Storage method and period of stock solution: -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture). When stored at -80°C, please use it within 6 months. When stored at -20°C, please use it within 1 month.
* Note: If you choose water as the stock solution, please dilute it to the working solution, then filter and sterilize it with a 0.22 μm filter before use.
Konzentration (Stammlösung) × Volumen (Stammlösung) = Konzentration (Ziellösung) × Volumen (Ziellösung)
Reinheit & Dokumentation
-
Data Sheet (270 KB)
-
SDS (252 KB)
- English - EN (252 KB)
- Français - FR (252 KB)
- Deutsch - DE (252 KB)
- Norwegian - NO (252 KB)
- Español - ES (252 KB)
- Swedish - SV (252 KB)
- Italian - IT (252 KB)
- Korean - KR (252 KB)
- Portuguese - PT (252 KB)
-
Handling Instructions (2659 KB)
Verweise
[1]. Marx U C, et al. Solution structures of human parathyroid hormone fragments hPTH (1–34) and hPTH (1–39) and bovine parathyroid hormone fragment bPTH (1–37)[J]. Biochemical and biophysical research communications, 2000, 267(1): 213-220. [Content Brief]
[2]. Tsai J A, et al. Parathyroid hormone-related protein (1–37) induces cAMP response in human osteoblast-like cells[J]. Calcified tissue international, 1998, 62(3): 250-254. [Content Brief]
Complete Stock Solution Preparation Table
Please refer to the solubility information to select the appropriate solvent. Once prepared, please aliquot and store the solution to prevent product inactivation from repeated freeze-thaw cycles.
Storage method and period of stock solution: -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture). When stored at -80°C, please use it within 6 months. When stored at -20°C, please use it within 1 month.
| Optional Solvent | Concentration Solvent Mass | 1 mg | 5 mg | 10 mg | 25 mg |
|---|---|---|---|---|---|
| H2O / DMSO | 1 mM | 0.2272 mL | 1.1361 mL | 2.2722 mL | 5.6804 mL |
| 5 mM | 0.0454 mL | 0.2272 mL | 0.4544 mL | 1.1361 mL | |
| 10 mM | 0.0227 mL | 0.1136 mL | 0.2272 mL | 0.5680 mL | |
| DMSO | 15 mM | 0.0151 mL | 0.0757 mL | 0.1515 mL | 0.3787 mL |
| 20 mM | 0.0114 mL | 0.0568 mL | 0.1136 mL | 0.2840 mL |
* Note: If you choose water as the stock solution, please dilute it to the working solution, then filter and sterilize it with a 0.22 μm filter before use.