Margatoxin TFA
Based on 1 publication(s) in Google Scholar
Margatoxin TFA, an alpha-KTx scorpion toxin, is a high affinity inhibitor of Kv1.3 (Kd=11.7 pM). Margatoxin TFA inhibits the Kv1.2 (Kd=6.4 pM) and Kv1.1 (Kd=4.2 nM). Margatoxin TFA, a 39 amino-acid-long peptide, is isolated from the venom of the scorpion Centruroides margaritatus and widely used in ion channel research.
Para uso exclusivo en investigación. No vendemos a pacientes.
- Fòrmula: C178H286N52O50S7.xC2HF3O2
- Peso molecular:4178.95 (free base)
-
Almacenamiento:
Please store the product under the recommended conditions in the Certificate of Analysis.
Publications Citing Use of MedChemExpress (MCE) Margatoxin TFA
More
Actividad biológica
Kd: 11.7 pM (Kv1.3), 6.4 pM (Kv1.2) and 4.2 nM (Kv1.1)[1]
MedChemExpress (MCE) has not independently confirmed the accuracy of these methods. They are for reference only.
Chemical Information
-
Peso molecular 4178.95 (free base)
-
Fòrmula C178H286N52O50S7.xC2HF3O2
-
Sequence
Thr-Ile-Ile-Asn-Val-Lys-Cys-Thr-Ser-Pro-Lys-Gln-Cys-Leu-Pro-Pro-Cys-Lys-Ala-Gln-Phe-Gly-Gln-Ser-Ala-Gly-Ala-Lys-Cys-Met-Asn-Gly-Lys-Cys-Lys-Cys-Tyr-Pro-His (Disulfide bridge:Cys7-Cys29;Cys13-Cys34;Cys17-Cys36)
-
Sequence Shortening
TIINVKCTSPKQCLPPCKAQFGQSAGAKCMNGKCKCYPH(Disulfide bridge:Cys7-Cys29;Cys13-Cys34;Cys17-Cys36)
-
Envío
Room temperature in continental US; may vary elsewhere.
-
Almacenamiento
Please store the product under the recommended conditions in the Certificate of Analysis.
Publications (1)
-
Journal Impact Factor
-
Most Recent
-
Cell Death Discov
Therapeutic potential of voltage-dependent potassium channel subtype 1.3 blockade in alleviating macrophage-related renal inflammation and fibrogenesis. [Abstract]2025 May 5;11(1):218. PMID: 40324999
Pureza y Documentación
Referencias
[1]. Bartok A, et al. Margatoxin is a non-selective inhibitor of human Kv1.3 K+ channels. Toxicon. 2014 Sep;87:6-16. [Content Brief]
[2]. Chen YC, et al. PreImplantation factor prevents atherosclerosis via its immunomodulatory effects without affecting serum lipids. Thromb Haemost. 2016 May 2;115(5):1010-24. [Content Brief]
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)