IL-20R alpha Protein, Human (HEK293, Fc)

IL-20R alpha Protein (IL20RA) is the alpha subunit of IL-20 receptor, forms functional heterodimers with different subunit protein and involves in STAT3 activation pathway^[1]. The IL20RA/IL20RB dimer is a receptor for IL-19, IL-20 and IL-24, while the IL20RA/IL10RB dimer is a receptor for IL-26^[3]. IL-20R alpha Protein is consists of 553 amino acids (M1-N553) with a transmembrane domain (251-271 a.a.). IL-20R alpha Protein, Human (HEK293, Fc) is produced in HEK293 cells with a C-Terminal hFc-tag.

IL-20R alpha, also known as a alpha subunit of IL-20 receptor (IL-20RA), belongs to the type II cytokine receptor family^[1].
IL-20R alpha is widely expressed with highest levels in skin and testis and high levels in brain^[2].
IL20RA and IL20RB is found to be upregulated in psoriatic skin lesions on keratinocytes^[3].
IL-20R alpha forms functional heterodimers with different subunit protein. IL-20R alpha serves as the receptor for IL-19, IL-20 and IL-24 by dimerizing with IL20RB, however serves as the receptor for IL-26 by dimerizing with IL-10RB. IL-20R alpha transduces ligand-binding at least in part through STAT3 activation, and plays an important role in epidermal function and psoriasis^[4].
The sequence of amino acids in IL-12 beta proteins of human is very different from mouse (64.64%).

IL-2 receptor mRNA is decreased in psoriasis, and shows high protein level in mononuclear leukocytes in the papillary dermis and along the dermoepidermal junction^[4].

Human

HEK293

C-hFc

Q9UHF4-1 (V30-K250)

53832  [NCBI]

Extracellular Domain

VPCVSGGLPKPANITFLSINMKNVLQWTPPEGLQGVKVTYTVQYFIYGQKKWLNKSECRNINRTYCDLSAETSDYEHQYYAKVKAIWGTKCSKWAESGRFYPFLETQIGPPEVALTTDEKSISVVLTAPEKWKRNPEDLPVSMQQIYSNLKYNVSVLNTKSNRTWSQCVTNHTLVLTWLEPNTLYCVHVESFVPGPPRRAQPSEKQCARTLKDQSSEFKAK

≥ 95%, as determined by reducing SDS-PAGE.

<1 EU/μg, determined by LAL method.

• [1]. Wang F, et al. Prominent production of IL-20 by CD68+/CD11c+ myeloid-derived cells in psoriasis: Gene regulation and cellular effects. J Invest Dermatol. 2006 Jul;126(7):1590-9.  [Content Brief]

  [2]. Blumberg H, et al. Interleukin 20: discovery, receptor identification, and role in epidermal function. Cell. 2001 Jan 12;104(1):9-19.  [Content Brief]

  [3]. Sheikh F, et al. Cutting edge: IL-26 signals through a novel receptor complex composed of IL-20 receptor 1 and IL-10 receptor 2. J Immunol. 2004 Feb 15;172(4):2006-10.  [Content Brief]