Phlotoxin-1 TFA
Phlotoxin-1 (PhlTx1) is a 34-amino acid and 3-disulfide bridge peptide. Phlotoxin-1 can be isolated from Phlogiellus genus spider. Phlotoxin-1 is an antinociceptive agent by inhibiting NaV1.7 channel.
Nur für Forschungszwecke. Wir verkaufen nicht an Patienten.
- Reinheit: 92.73%
- Formel: C183H254N46O48S6.xC2HF3O2
- Molecular Weight:4058.64 (free base)
-
Speicherung:
Sealed storage, away from moisture.
Powder -80°C, 2 years , -20°C, 1 year* In solvent : -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture)
Biologische Aktivität
Chemical Information
-
Appearance Solid
-
Molecular Weight 4058.64 (free base)
-
Formel C183H254N46O48S6.xC2HF3O2
-
Color White to off-white
-
Synonyms
PhlTx1 TFA
-
Sequence
Ala-Cys-Leu-Gly-Gln-Trp-Asp-Ser-Cys-Asp-Pro-Lys-Ala-Ser-Lys-Cys-Cys-Pro-Asn-Tyr-Ala-Cys-Glu-Trp-Lys-Tyr-Pro-Trp-Cys-Arg-Tyr-Lys-Leu-Phe (Disulfide bridge: Cys2-Cys17, Cys9-Cys22, Cys16-Cys29)
-
Sequence Shortening
ACLGQWDSCDPKASKCCPNYACEWKYPWCRYKLF (Disulfide bridge: Cys2-Cys17, Cys9-Cys22, Cys16-Cys29)
-
Versand
Room temperature in continental US; may vary elsewhere.
-
Speicherung
Sealed storage, away from moisture
Powder -80°C 2 years -20°C 1 year * In solvent : -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture)
Lösungsmittel & Löslichkeit
DMSO : 100 mg/mL (Need ultrasonic; Hygroscopic DMSO has a significant impact on the solubility of product, please use newly opened DMSO)
Reinheit & Dokumentation
-
Data Sheet (290 KB)
-
SDS (252 KB)
- English - EN (252 KB)
- Français - FR (252 KB)
- Deutsch - DE (252 KB)
- Norwegian - NO (252 KB)
- Español - ES (252 KB)
- Swedish - SV (252 KB)
- Italian - IT (252 KB)
- Korean - KR (252 KB)
- Portuguese - PT (252 KB)
-
Handling Instructions (2659 KB)
Verweise
[1]. Gonçalves TC, et al. Evaluation of the Spider (Phlogiellus genus) Phlotoxin 1 and Synthetic Variants as Antinociceptive Drug Candidates. Toxins (Basel). 2019 Aug 22;11(9):484. [Content Brief]
[2]. Nicolas S, et al. Chemical Synthesis, Proper Folding, Nav Channel Selectivity Profile and Analgesic Properties of the Spider Peptide Phlotoxin 1. Toxins (Basel). 2019 Jun 21;11(6):367. [Content Brief]
Calculators
Konzentration (Stammlösung) × Volumen (Stammlösung) = Konzentration (Ziellösung) × Volumen (Ziellösung)