Vosoritide acetate
Based on 1 Customer Validation
Vosoritide (BMN 111) acetate is a natriuretic peptide receptor 2 (NPR2) agonist that acts on the proliferation and differentiation of chondrocytes to promote bone growth.
Nos produits utilisent uniquement pour la recherche. Nous ne vendons pas aux patients.
- Pureté: 99.96%
- Formule: C176H290N56O51S3.C2H4O2
- Masse moléculaire:4162.78
-
Stockage:
Please store the product under the recommended conditions in the Certificate of Analysis.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Activité biologique
-
Chemical Information
-
Solvant et solubilité
- Pureté et documentation
- Références
-
Help & FAQs
Activité biologique
Vosoritide (0.1 μM; 1 h) acetate decreases NPR2 phosphorylation in chondrocytes[2].
Vosoritide (0.1 μM; 6 d) acetate improves chondrocyte differentiation and increases the proliferative growth plate area of cultured Fgfr3Y367C/+ femurs[2].
Vosoritide (10 μM; overnight) acetate reduces ERK1/2 activation in ACH growth-plate chondrocytes[3].
MedChemExpress (MCE) has not independently confirmed the accuracy of these methods. They are for reference only.
-
Cell Line:Chondrocyte cultures
-
Concentration:0.1 μM
-
Incubation Time:1 hour
-
Result:Led to reduction in NPR2 phosphorylation.
-
Cell Line:Chondrocyte
-
Concentration:10 μM
-
Incubation Time:Overnight
-
Result:Prevented FGF-mediated increase in ERK1/2 phosphorylation.
MedChemExpress (MCE) has not independently confirmed the accuracy of these methods. They are for reference only.
-
Animal Model:Fgfr3Y367C/+ mice[3]
-
Dosage:800 μg/kg
-
Administration:Subcutaneous injection; 800 μg/kg; once daily; 20 days
-
Result:Observed phenotypic changes including flattening of the skull, elongation of the snout, improvement of the anterior crossbite, larger paws and digits, and longer and straightened tibias and femurs.
| NCT Number | Sponsor | Condition | Start Date |
Phase
|
|---|---|---|---|---|
| NCT01329991 | Plexxikon| | 2011-05 | PHASE1 |
Chemical Information
-
Appearance Solid
-
Masse moléculaire 4162.78
-
Formule C176H290N56O51S3.C2H4O2
-
Color White to off-white
-
Synonyms
BMN 111 acetate
-
Sequence
Pro-Gly-Gln-Glu-His-Pro-Asn-Ala-Arg-Lys-Tyr-Lys-Gly-Ala-Asn-Lys-Lys-Gly-Leu-Ser-Lys-Gly-Cys-Phe-Gly-Leu-Lys-Leu-Asp-Arg-Ile-Gly-Ser-Met-Ser-Gly-Leu-Gly-Cys (Disulfide bridge:Cys23-Cys39)
-
Sequence Shortening
PGQEHPNARKYKGANKKGLSKGCFGLKLDRIGSMSGLGC (Disulfide bridge:Cys23-Cys39)
-
Livraison
Room temperature in continental US; may vary elsewhere.
-
Stockage
Please store the product under the recommended conditions in the Certificate of Analysis.
Solvant et solubilité
H2O : ≥ 100 mg/mL (24.02 mM)
* "≥" means soluble, but saturation unknown.
* Note: If you choose water as the stock solution, please dilute it to the working solution, then filter and sterilize it with a 0.22 μm filter before use.
* Note: If you choose water as the stock solution, please dilute it to the working solution, then filter and sterilize it with a 0.22 μm filter before use.
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Pureté et documentation
-
Fiche technique (293 KB)
-
SDS (254 KB)
- English - EN (254 KB)
- Français - FR (254 KB)
- Deutsch - DE (254 KB)
- Norwegian - NO (254 KB)
- Español - ES (254 KB)
- Swedish - SV (254 KB)
- Italian - IT (254 KB)
- Korean - KR (254 KB)
- Portuguese - PT (254 KB)
-
Instruction de manipulation (2659 KB)
Références
[2]. Shuhaibar LC, et al. Phosphatase inhibition by LB-100 enhances BMN-111 stimulation of bone growth. JCI Insight. 2021 May 10;6(9):e141426. [Content Brief]
[3]. Lorget F, et al. Evaluation of the therapeutic potential of a CNP analog in a Fgfr3 mouse model recapitulating achondroplasia. Am J Hum Genet. 2012 Dec 7;91(6):1108-14. [Content Brief]
Complete Stock Solution Preparation Table
| Optional Solvent | Concentration Solvent Mass | 1 mg | 5 mg | 10 mg | 25 mg |
|---|---|---|---|---|---|
| H2O | 1 mM | 0.2402 mL | 1.2011 mL | 2.4022 mL | 6.0056 mL |
| 5 mM | 0.0480 mL | 0.2402 mL | 0.4804 mL | 1.2011 mL | |
| 10 mM | 0.0240 mL | 0.1201 mL | 0.2402 mL | 0.6006 mL | |
| 15 mM | 0.0160 mL | 0.0801 mL | 0.1601 mL | 0.4004 mL | |
| 20 mM | 0.0120 mL | 0.0601 mL | 0.1201 mL | 0.3003 mL |
* Note: If you choose water as the stock solution, please dilute it to the working solution, then filter and sterilize it with a 0.22 μm filter before use.
Vosoritide acetate Related Classifications
HY-P3503A Related Classifications
Powered by Bioz