country

Change Language

EN - English
FR - Français
DE - Deutsch
ES - Español
JA - 日本語
KO - 한국어

Product Name	Size / Unit Price	Qty

Total: USD 0.00 Checkout

Referencia número: HY-P2785A

Copy Link Print Information

Phrixotoxin-1 TFA

Revisión del cliente

Based on 1 Customer Validation

Phrixotoxin-1 (TFA), from the venom of the theraphosid spider Phrixotrichus auratus, is a specific peptide inhibitor of Kv4 potassium channel.

Para uso exclusivo en investigación. No vendemos a pacientes.

Pureza: 96.46%
Fòrmula: C₁₅₆H₂₄₀N₄₄O₃₇S₇.xC₂HF₃O₂
Peso molecular:3548.30 (free base)

Almacenamiento:

Sealed storage, away from moisture and light.

Powder -80°C, 2 years , -20°C, 1 year

* In solvent : -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture and light)

Phrixotoxin-1 TFA Chemical Structure

Tamaño

Precio

Stock

Cantidad

Amount: USD 0.00

* Seleccione Cantidad antes de agregar artículos.

Top Publications Citing

Use of MCE Products

Fluorescent Dye

Strong Fluorescence Signal / Multi-Disciplinary Applications / High Fluorescence Specificity

Actividad biológica

Descripciòn

Phrixotoxin-1 (TFA), from the venom of the theraphosid spider Phrixotrichus auratus, is a specific peptide inhibitor of Kv4 potassium channel^[1]^[2].

Chemical Information

Appearance Solid
Peso molecular 3548.30 (free base)
Fòrmula C₁₅₆H₂₄₀N₄₄O₃₇S₇.xC₂HF₃O₂
Color White to off-white
Sequence

Tyr-Cys-Gln-Lys-Trp-Met-Trp-Thr-Cys-Asp-Ser-Ala-Arg-Lys-Cys-Cys-Glu-Gly-Leu-Val-Cys-Arg-Leu-Trp-Cys-Lys-Lys-Ile-Ile-NH2 (Disulfide bridge: Cys2-Cys16; Cys9-Cys21; Cys15-Cys25)
Sequence Shortening

YCQKWMWTCDSARKCCEGLVCRLWCKKII-NH2 (Disulfide bridge: Cys2-Cys16; Cys9-Cys21; Cys15-Cys25)
Envío

Room temperature in continental US; may vary elsewhere.

Almacenamiento

Sealed storage, away from moisture and light

Powder	-80°C	2 years
	-20°C	1 year

* In solvent : -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture and light)

Solvente y solubilidad

In Vitro:

H₂O : ≥ 100 mg/mL

* "≥" means soluble, but saturation unknown.

View the Complete Stock Solution Preparation Table

Pureza y Documentación

Select Batch:

Pureza: 99.98%

Assay: 99.98%

ee.: 99.98%

Ficha de datos (283 KB)
SDS (252 KB)
- English - EN (252 KB)
- Français - FR (252 KB)
- Deutsch - DE (252 KB)
- Norwegian - NO (252 KB)
- Español - ES (252 KB)
- Swedish - SV (252 KB)
- Italian - IT (252 KB)
- Korean - KR (252 KB)
- Portuguese - PT (252 KB)
COA (2659 KB)
Elemental Analysis Report (2659 KB)
HNMR (2659 KB)
CNMR (2659 KB)
RP-HPLC (2659 KB)
NP-HPLC (2659 KB)
MS (2659 KB)
LCMS (2659 KB)
IR (2659 KB)
GC (2659 KB)
OR (2659 KB)
SDS-PAGE (2659 KB)
SEC-HPLC (2659 KB)
Other Report (2659 KB)
Instrucciones de manejo (2659 KB)

Referencias

[1]. Benjamin Chagot, et al. Solution structure of Phrixotoxin 1, a specific peptide inhibitor of Kv4 potassium channels from the venom of the theraphosid spider Phrixotrichus auratus. Protein Sci. 2004, 13, 5. [Content Brief]

[2]. Grit Schaarschmidt, et al. Characterization of Voltage-Gated Potassium Channels in Human Neural Progenitor Cells. PLoS One. 2009, 4, 7. [Content Brief]

Calculators

Calculadora de molaridad

Mass (g) = Concentration (mol/L) × Volume (L) × Molecular Weight (g/mol)

Mass Mass

Concentration Concentration

Volume Volume

Molecular Weight Molecular Weight

Calculadora de dilución

Concentration _(start) × Volume _(start) = Concentration _(final) × Volume _(final)

Concentration _(start) Concentration _(start)

Volume _(start) Volume _(start)

Concentration _(final) Concentration _(final)

Volume _(final) Volume _(final)

Help & FAQs

How should lyophilized recombinant proteins be reconstituted and stored?

1. Before opening the cap, centrifuge the vial at 13000 rpm for 20-30 seconds. This step will ensure that any lyophilized powder that may have adhered to the cap or walls is collected at the bottom of the vial, minimizing the risk of product loss.

Keywords

100 mg

Obtener un presupuesto En stock

Amount: USD 0.00

Actividad biológica
- Descripciòn
Chemical Information
Solvente y solubilidad
- In Vitro
Pureza y Documentación
Referencias

Nombre del producto:
Referencia número:
Cantidad:
MCE Japan Authorized Agent:

Nombre del producto:
No. CAS:
Species:
Pureza:
Cantidad:

Phrixotoxin-1 TFA

Peptide Library