1. Peptides
  2. Peptide and Derivatives
  3. Others
  4. Nanodisc scaffold peptide

Nanodisc scaffold peptide  (Synonyms: NSPr)

Cat. No.: HY-P10626 Purity: 99.39%
Handling Instructions Technical Support

Nanodisc scaffold peptide (NSPr) is an amphipathic double-helical peptide that stabilizes membrane proteins by mimicking their natural environment, allowing them to remain stable and active in detergent-free aqueous solutions. Nanodisc scaffold peptide can be used to construct a universal tool for high-throughput stabilization of membrane proteins, facilitating modern biological research.

For research use only. We do not sell to patients.

Custom Peptide Synthesis

Nanodisc scaffold peptide

Nanodisc scaffold peptide Chemical Structure

Size Price Stock Quantity
1 mg In-stock
5 mg In-stock
10 mg In-stock
25 mg In-stock
50 mg   Get quote  
100 mg   Get quote  

* Please select Quantity before adding items.

This product is a controlled substance and not for sale in your territory.

Customer Review

Based on 1 Customer Validation

Top Publications Citing Use of Products
  • Biological Activity

  • Purity & Documentation

  • References

  • Customer Review

Description

Nanodisc scaffold peptide (NSPr) is an amphipathic double-helical peptide that stabilizes membrane proteins by mimicking their natural environment, allowing them to remain stable and active in detergent-free aqueous solutions. Nanodisc scaffold peptide can be used to construct a universal tool for high-throughput stabilization of membrane proteins, facilitating modern biological research[1].

Molecular Weight

4474.07

Formula

C217H311N47O56

Appearance

Solid

Color

White to off-white

Sequence

Phe-Ala-Glu-Lys-Phe-Lys-Glu-Ala-Val-Lys-Asp-Tyr-Phe-Ala-Lys-Phe-Trp-Asp-Pro-Ala-Ala-Glu-Lys-Leu-Lys-Glu-Ala-Val-Lys-Asp-Tyr-Phe-Ala-Lys-Leu-Trp-Asp

Sequence Shortening

FAEKFKEAVKDYFAKFWDPAAEKLKEAVKDYFAKLWD

Shipping

Room temperature in continental US; may vary elsewhere.

Storage

Sealed storage, away from moisture

Powder -80°C 2 years
-20°C 1 year

*In solvent : -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture)

Solvent & Solubility
In Vitro: 

DMSO : 25 mg/mL (5.59 mM; Need ultrasonic; Hygroscopic DMSO has a significant impact on the solubility of product, please use newly opened DMSO)

H2O : 25 mg/mL (5.59 mM; Need ultrasonic)

Preparing
Stock Solutions
Concentration Solvent Mass 1 mg 5 mg 10 mg
1 mM 0.2235 mL 1.1176 mL 2.2351 mL
5 mM 0.0447 mL 0.2235 mL 0.4470 mL
View the Complete Stock Solution Preparation Table

* Please refer to the solubility information to select the appropriate solvent. Once prepared, please aliquot and store the solution to prevent product inactivation from repeated freeze-thaw cycles.
Storage method and period of stock solution: -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture). When stored at -80°C, please use it within 6 months. When stored at -20°C, please use it within 1 month.

* Note: If you choose water as the stock solution, please dilute it to the working solution, then filter and sterilize it with a 0.22 μm filter before use.

  • Molarity Calculator

  • Dilution Calculator

Mass (g) = Concentration (mol/L) × Volume (L) × Molecular Weight (g/mol)

Mass
=
Concentration
×
Volume
×
Molecular Weight *

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start)

C1

×
Volume (start)

V1

=
Concentration (final)

C2

×
Volume (final)

V2

In Vivo Dissolution Calculator
Please enter the basic information of animal experiments:

Dosage

mg/kg

Animal weight
(per animal)

g

Dosing volume
(per animal)

μL

Number of animals

Recommended: Prepare an additional quantity of animals to account for potential losses during experiments.
Calculation results:
Working solution concentration: mg/mL
This product has good water solubility, please refer to the measured solubility data in water/PBS/Saline for details.
The concentration of the stock solution you require exceeds the measured solubility. The following solution is for reference only.If necessary, please contact MedChemExpress (MCE).
Purity & Documentation
References

Complete Stock Solution Preparation Table

* Please refer to the solubility information to select the appropriate solvent. Once prepared, please aliquot and store the solution to prevent product inactivation from repeated freeze-thaw cycles.
Storage method and period of stock solution: -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture). When stored at -80°C, please use it within 6 months. When stored at -20°C, please use it within 1 month.

Optional Solvent Concentration Solvent Mass 1 mg 5 mg 10 mg 25 mg
DMSO / H2O 1 mM 0.2235 mL 1.1176 mL 2.2351 mL 5.5878 mL
5 mM 0.0447 mL 0.2235 mL 0.4470 mL 1.1176 mL

* Note: If you choose water as the stock solution, please dilute it to the working solution, then filter and sterilize it with a 0.22 μm filter before use.

  • No file chosen (Maximum size is: 1024 Kb)
  • If you have published this work, please enter the PubMed ID.
  • Your name will appear on the site.

Nanodisc scaffold peptide Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Nanodisc scaffold peptide
Cat. No.:
HY-P10626
Quantity:
MCE Japan Authorized Agent: