1. Recombinant Proteins
  2. Enzymes & Regulators
  3. Lyases (EC 4)
  4. CA5A Protein, Human (His)

CA5A protein is a mitochondrial carbonic anhydrase that catalyzes the reversible conversion of carbon dioxide to bicarbonate/HCO3, providing essential bicarbonate for mitochondrial enzymes. Impermeable mitochondria rely on CA5A to support enzymatic reactions critical to intermediary metabolism, including the urea cycle and the Krebs cycle. CA5A Protein, Human (His) is the recombinant human-derived CA5A protein, expressed by E. coli , with N-Met, C-His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
10 μg In-stock
50 μg In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

CA5A protein is a mitochondrial carbonic anhydrase that catalyzes the reversible conversion of carbon dioxide to bicarbonate/HCO3, providing essential bicarbonate for mitochondrial enzymes. Impermeable mitochondria rely on CA5A to support enzymatic reactions critical to intermediary metabolism, including the urea cycle and the Krebs cycle. CA5A Protein, Human (His) is the recombinant human-derived CA5A protein, expressed by E. coli , with N-Met, C-His labeled tag.

Background

CA5A protein is a mitochondrial carbonic anhydrase crucial for the reversible conversion of carbon dioxide to bicarbonate/HCO3 within the mitochondria, as indicated by its catalytic activity. Given that mitochondria are impermeable to HCO3, the role of CA5A becomes pivotal in supplying bicarbonate for various mitochondrial enzymes. These enzymes are integral to the synthesis of essential metabolites in intermediary metabolism, particularly in processes such as the urea and Krebs cycles. The activity of CA5A underscores its significance in maintaining the metabolic integrity of mitochondrial functions by facilitating the availability of bicarbonate for key enzymatic reactions.

Biological Activity

Measured by its esterase activity. The specific activity is >500 pmoles/min/μg.

Species

Human

Source

E. coli

Tag

C-His

Accession

P35218 (A40-S305)

Gene ID

763  [NCBI]

Molecular Construction
N-term
Met
CA5A (A40-S305)
Accession # P35218
His
C-term
Protein Length

Full Length of Mature Protein

Synonyms
Carbonic anhydrase 5A, mitochondrial; Carbonic anhydrase VA; CA-VA; CA5
AA Sequence

AWQTSNNTLHPLWTVPVSVPGGTRQSPINIQWRDSVYDPQLKPLRVSYEAASCLYIWNTGYLFQVEFDDATEASGISGGPLENHYRLKQFHFHWGAVNEGGSEHTVDGHAYPAELHLVHWNSVKYQNYKEAVVGENGLAVIGVFLKLGAHHQTLQRLVDILPEIKHKDARAAMRPFDPSTLLPTCWDYWTYAGSLTTPPLTESVTWIIQKEPVEVAPSQLSAFRTLLFSALGEEEKMMVNNYRPLQPLMNRKVWASFQATNEGTRS

Molecular Weight

Approximately 33 kDa

Purity

≥ 95%, as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of 50 mM NaAc, 50 mM NaCl, 0.05% Brij 35, pH 5.0, 5% trehalose, 5% mannitol and 0.01% Tween 80.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

CA5A Protein, Human (His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

CA5A Protein, Human (His)

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
CA5A Protein, Human (His)
Cat. No.:
HY-P76753
Quantity:
MCE Japan Authorized Agent: