CA5A Protein, Human (His)
Based on 1 Customer Validation
CA5A protein is a mitochondrial carbonic anhydrase that catalyzes the reversible conversion of carbon dioxide to bicarbonate/HCO3, providing essential bicarbonate for mitochondrial enzymes. Impermeable mitochondria rely on CA5A to support enzymatic reactions critical to intermediary metabolism, including the urea cycle and the Krebs cycle. CA5A Protein, Human (His) is the recombinant human-derived CA5A protein, expressed by E. coli , with N-Met, C-His labeled tag.
- Species: Human
- Source: E. coli
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
CA5A protein is a mitochondrial carbonic anhydrase that catalyzes the reversible conversion of carbon dioxide to bicarbonate/HCO3, providing essential bicarbonate for mitochondrial enzymes. Impermeable mitochondria rely on CA5A to support enzymatic reactions critical to intermediary metabolism, including the urea cycle and the Krebs cycle. CA5A Protein, Human (His) is the recombinant human-derived CA5A protein, expressed by E. coli , with N-Met, C-His labeled tag.
CA5A protein is a mitochondrial carbonic anhydrase crucial for the reversible conversion of carbon dioxide to bicarbonate/HCO3 within the mitochondria, as indicated by its catalytic activity. Given that mitochondria are impermeable to HCO3, the role of CA5A becomes pivotal in supplying bicarbonate for various mitochondrial enzymes. These enzymes are integral to the synthesis of essential metabolites in intermediary metabolism, particularly in processes such as the urea and Krebs cycles. The activity of CA5A underscores its significance in maintaining the metabolic integrity of mitochondrial functions by facilitating the availability of bicarbonate for key enzymatic reactions.
Measured by its esterase activity. The specific activity is >500 pmoles/min/μg.
Technical Parameters
-
Species Human
-
Source E. coli
-
Tag C-His
-
Accession
P35218 (A40-S305)
-
Molecular Construction
-
N-term
-
Met
-
CA5A (A40-S305)
Accession # P35218 -
His
-
C-term
-
-
Protein Length
Full Length of Mature Protein
-
Synonyms
CA5A; CA-VA; Prev. CA5; Carbonic Anhydrase VA; CAVA; Carbonic Dehydratase; CAV; Carbonic Anhydrase; Carbonic Anhydrase VA, Mitochondrial; GS1-21A4.1; Carbonic Anhydrase 5A, Mitochondrial; CA5AD; Carbonate Dehydratase VA; Carbonic Anhydrase 5A; Carbonic An
-
AA Sequence
AWQTSNNTLHPLWTVPVSVPGGTRQSPINIQWRDSVYDPQLKPLRVSYEAASCLYIWNTGYLFQVEFDDATEASGISGGPLENHYRLKQFHFHWGAVNEGGSEHTVDGHAYPAELHLVHWNSVKYQNYKEAVVGENGLAVIGVFLKLGAHHQTLQRLVDILPEIKHKDARAAMRPFDPSTLLPTCWDYWTYAGSLTTPPLTESVTWIIQKEPVEVAPSQLSAFRTLLFSALGEEEKMMVNNYRPLQPLMNRKVWASFQATNEGTRS
-
Predicted Molecular Mass
31.6 kDa
-
Molecular Weight
Approximately 33 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
Lyophilized from a 0.22 μm filtered solution of 50 mM NaAc, 50 mM NaCl, 0.05% Brij 35, pH 5.0, 5% trehalose, 5% mannitol and 0.01% Tween 80.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (236 KB)
-
SDS (251 KB)
- English - EN (251 KB)
- Français - FR (251 KB)
- Deutsch - DE (251 KB)
- Norwegian - NO (251 KB)
- Español - ES (251 KB)
- Swedish - SV (251 KB)
- Italian - IT (251 KB)
- Korean - KR (251 KB)
- Portuguese - PT (251 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
