Copy Link Print Information

CBFA2T3 Protein, Human (His, Strep)

CBFA2T3 Protein, Human (His, Strep) is the recombinant human-derived CBFA2T3, expressed by E. coli , with Strep, His labeled tag.

For research use only. We do not sell to patients.
  • Species: Human
  • Source: E. coli
  • CBFA2T3 Protein, Human (His, Strep) Product Image
Size
Price
Stock
Quantity
Amount: USD 0.00
Please select quantity
or
or

* Please select Quantity before adding items.

To place orders, for customer services and technical support, please contact: MedChemExpress USA

Tel: 609-228-6898 E-mail: [email protected] [email protected]

Service
Data Download

To place orders, for customer services and technical support, please contact:

609-228-6898
[email protected] [email protected]
Find Your Local Distributor Your local distributor: Hycultec GmbHHycultec
  • Biological Activity
  • Product Properties
  • Documentation
  • Help & FAQs
Top Publications Citing

Use of MCE Products

Biological Activity

Description

CBFA2T3 Protein, Human (His, Strep) is the recombinant human-derived CBFA2T3, expressed by E. coli , with Strep, His labeled tag.

Background

CBFA2T3 is a transcriptional corepressor that facilitates gene silencing by associating with DNA-binding transcription factors and recruiting other corepressors or histone-modifying enzymes (e.g., EGLN1). It represses MMP7 expression in a ZBTB33-dependent manner and promotes HIF1A prolyl hydroxylation-dependent ubiquitination and degradation via interaction with EGLN1, thereby reducing HIF1A protein stability. Additionally, CBFA2T3 downregulates glycolytic genes (e.g., PFKFB3, PFKFB4, PDK1, PFKP, LDHA, HK1)—direct targets of HIF1A—to suppress glycolysis and enhance mitochondrial respiration. It regulates erythroid progenitor proliferation/differentiation by inhibiting TAL1 target genes (by similar) and contributes to granulocyte differentiation.

Technical Parameters

  • Species Human
  • Source E. coli
  • Tag Strep;His
  • Accession

    O75081-1 (G170-S276)

  • Gene ID
    863
  • Protein Length

    Partial

  • Synonyms

    CBFA2T3; Zinc Finger MYND Domain-Containing Protein 4; CBFA2/RUNX1 Partner Transcriptional Co-Repressor 3; Myeloid Translocation Gene 8 And 16b; ZMYND4; CBFA2/RUNX1 Translocation Partner 3; MTG16; Transcriptional Corepressor CBFA2T3; MTGR2; MTG8-Related P

  • AA Sequence

    GARQLSKLKRFLTTLQQFGSDISPEIGERVRTLVLGLVNSTLTIEEFHSKLQEATNFPLRPFVIPFLKANLPLLQRELLHCARLAKQTPAQYLAQHEQLLLDASASS

  • Predicted Molecular Mass

    15 kDa

  • Purity

    ≥ 90%, as determined by reducing SDS-PAGE.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00

Measured by its ability to inhibit anti-CD3-induced proliferation of stimulated CTLL-2 mouse cytotoxic T cells. The ED50 this effect is 0.8023 μg/ml, corresponding to a specific activity is 1246.42 units/mg.

Assay Types
  • CBFA2T3 Protein, Human (His, Strep) Product Image
    1/16
  • CBFA2T3 Protein, Human (His, Strep) Product Image