FABP12 Protein, Human
FABP12 Protein, Human is the recombinant human-derived FABP12, expressed by E. coli , with tag Free labeled tag.
- Species: Human
- Source: E. coli
-
Storage:Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
FABP12 Protein, Human is the recombinant human-derived FABP12, expressed by E. coli , with tag Free labeled tag.
FABP12 is a protein that may play a role in lipid transport. by similar: This function is inferred from similar proteins.
Technical Parameters
-
Species Human
-
Source E. coli
-
Tag Tag Free
-
Accession
A6NFH5 (M1-S140)
-
Gene ID646486
-
Protein Length
Full Length
-
Synonyms
FABP12; Probable Fatty Acid-Binding Protein ENSP00000353650; Fatty Acid Binding Protein 12; Intracellular Fatty Acid-Binding Protein FABP12; Fatty Acid-Binding Protein 12; Fatty Acid Binding Protein ORF
-
AA Sequence
MIDQLQGTWKSISCENSEDYMKELGIGRASRKLGRLAKPTVTISTDGDVITIKTKSIFKNNEISFKLGEEFEEITPGGHKTKSKVTLDKESLIQVQDWDGKETTITRKLVDGKMVVESTVNSVICTRTYEKVSSNSVSNS
-
Predicted Molecular Mass
15.8 kDa
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Solution.
<1 EU/μg, determined by LAL method.
Please use rapid thawing with running water to thaw the protein.
Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Shipping with dry ice.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
