HCFC2 Protein, Mouse (His)
HCFC2 protein is critically involved in cellular processes by binding to KMT2A/MLL1 and participating in the MLL1/MLL complex. This complex, characterized by KMT2A/MLL1, ASH2L, RBBP5, DPY30, WDR5, MEN1, HCFC1, and HCFC2, plays a key role in epigenetic regulation and gene expression. HCFC2 Protein, Mouse (His) is the recombinant mouse-derived HCFC2 protein, expressed by E. coli , with N-6*His labeled tag.
- Species: Mouse
- Source: E. coli
-
Storage:Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
HCFC2 protein is critically involved in cellular processes by binding to KMT2A/MLL1 and participating in the MLL1/MLL complex. This complex, characterized by KMT2A/MLL1, ASH2L, RBBP5, DPY30, WDR5, MEN1, HCFC1, and HCFC2, plays a key role in epigenetic regulation and gene expression. HCFC2 Protein, Mouse (His) is the recombinant mouse-derived HCFC2 protein, expressed by E. coli , with N-6*His labeled tag.
The HCFC2 Protein plays a critical role in cellular processes by binding to KMT2A/MLL1 and functioning as a component of the MLL1/MLL complex. This complex, composed of KMT2A/MLL1, ASH2L, RBBP5, DPY30, WDR5, MEN1, HCFC1, and HCFC2, is involved in epigenetic regulation and gene expression. Additionally, HCFC2 interacts with TASOR, indicating its association with molecular complexes that contribute to various cellular functions. These interactions underscore the significance of HCFC2 in the intricate machinery of epigenetic regulation and chromatin modification.
Technical Parameters
-
Species Mouse
-
Source E. coli
-
Tag N-6*His
-
Accession
G5E837 (M1-E486)
-
Gene ID67933 [NCBI]
-
Molecular Construction
-
N-term
-
6*His
-
HCFC2 (M1-E486)
Accession # G5E837 -
C-term
-
-
Protein Length
Partial
-
Synonyms
HCFC2; Host Cell Factor 2; Host Cell Factor C2; C2 Factor; HCF-2; HCF2
-
AA Sequence
MAAPSLLNWRRVSSFTGPVPRARHGHRAVAIRELMIIFGGGNEGIADELHVYNTVTNQWFLPAVRGDIPPGCAAHGFVCDGTRILVFGGMVEYGRYSNELYELQASRWLWKKVKPQPPPSGFPPCPRLGHSFSLYGNKCYLFGGLANESEDSNNNVPRYLNDFYELELQHGSGVVGWSIPATKGVVPSPRESHTAIIYCKKDSASPKMYVFGGMCGARLDDLWQLDLETMSWSKPETKGTVPLPRSLHTASVIGNKMYIFGGWVPHKGENPETSPHDCEWRCTSSFSYLNLDTAEWTTLVSDSQEDKKNSRPRPRAGHCAVAIGTRLYFWSGRDGYKKALNSQVCCKDLWYLDTEKPPAPSQVQLIKATTNSFHVKWDEVPTVEGYLLQLNTDLTYQATSSDSSAAPSVLGGRMDPHRQGSNSTLHNSVSDTVNSTKTEHTAVRGTSLRSKPDSRAVDSSAALHSPLAPNTSNNSSWVTDMLRKNE
-
Predicted Molecular Mass
55.2 kDa
-
Molecular Weight
Approximately 55 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Solution
<1 EU/μg, determined by LAL method.
Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Shipping with dry ice.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
